Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 873133..873764 Replicon chromosome
Accession NZ_CP104557
Organism Pseudomonas promysalinigenes strain RL-WG26

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag N5C08_RS04050 Protein ID WP_261744775.1
Coordinates 873133..873360 (+) Length 76 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag N5C08_RS04055 Protein ID WP_060485575.1
Coordinates 873357..873764 (+) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5C08_RS04025 (N5C08_04025) 869463..870440 - 978 WP_261744772.1 hypothetical protein -
N5C08_RS04030 (N5C08_04030) 870451..870939 - 489 WP_060478493.1 type VI secretion system tube protein Hcp -
N5C08_RS04035 (N5C08_04035) 871234..871578 - 345 WP_003258412.1 cupin domain-containing protein -
N5C08_RS04040 (N5C08_04040) 871675..872613 - 939 WP_261744773.1 CDF family Co(II)/Ni(II) efflux transporter DmeF -
N5C08_RS04045 (N5C08_04045) 872684..872959 + 276 WP_261744774.1 metal/formaldehyde-sensitive transcriptional repressor -
N5C08_RS04050 (N5C08_04050) 873133..873360 + 228 WP_261744775.1 type II toxin-antitoxin system HicA family toxin Toxin
N5C08_RS04055 (N5C08_04055) 873357..873764 + 408 WP_060485575.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N5C08_RS04060 (N5C08_04060) 873875..874759 - 885 WP_261744776.1 LysR substrate-binding domain-containing protein -
N5C08_RS04065 (N5C08_04065) 874838..875602 + 765 WP_261744777.1 sulfite exporter TauE/SafE family protein -
N5C08_RS04070 (N5C08_04070) 875592..875906 - 315 WP_261744778.1 putative quinol monooxygenase -
N5C08_RS04075 (N5C08_04075) 876065..876655 + 591 WP_060478496.1 NAD(P)H-dependent oxidoreductase -
N5C08_RS04080 (N5C08_04080) 876686..877582 + 897 WP_261744779.1 LysR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 76 a.a.        Molecular weight: 8323.31 Da        Isoelectric Point: 9.8676

>T258434 WP_261744775.1 NZ_CP104557:873133-873360 [Pseudomonas promysalinigenes]
MRSREVIQLIEADGWYEVEVKGSHHQFRHPTKKGRVTVPHPKSDLPTSTVHSILKQAGLKQSSGFDSSNISGDAQ

Download         Length: 228 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 14605.40 Da        Isoelectric Point: 4.7169

>AT258434 WP_060485575.1 NZ_CP104557:873357-873764 [Pseudomonas promysalinigenes]
MKFPVVLHKDADSDYGVTVPDVPGCFSAGSTVAQALENVQEALALHFEGLVADNEALPQAQEVDVHVANSDYAGGVWAVV
DFDVTPYLGKAVRFNATLPENLLQRIDEKVKRDHRYASRSGFLASAALRELALAH

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References