Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 871148..871686 Replicon chromosome
Accession NZ_CP104555
Organism Vibrio sp. J502

Toxin (Protein)


Gene name parE Uniprot ID A0A7X8U0Q7
Locus tag N5E84_RS19830 Protein ID WP_019282621.1
Coordinates 871387..871686 (+) Length 100 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A289GHF4
Locus tag N5E84_RS19825 Protein ID WP_019282620.1
Coordinates 871148..871390 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5E84_RS19800 (N5E84_19800) 866291..866668 - 378 WP_019283451.1 hypothetical protein -
N5E84_RS19805 (N5E84_19805) 866718..866828 - 111 Protein_789 DUF3265 domain-containing protein -
N5E84_RS19810 (N5E84_19810) 866825..867538 - 714 WP_019283452.1 Fic family protein -
N5E84_RS19815 (N5E84_19815) 869329..869844 - 516 WP_019283453.1 peptide deformylase -
N5E84_RS19820 (N5E84_19820) 870085..871053 + 969 WP_081245536.1 IS30 family transposase -
N5E84_RS19825 (N5E84_19825) 871148..871390 + 243 WP_019282620.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
N5E84_RS19830 (N5E84_19830) 871387..871686 + 300 WP_019282621.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5E84_RS19835 (N5E84_19835) 871737..872626 - 890 Protein_795 IS256 family transposase -
N5E84_RS19840 (N5E84_19840) 872708..873028 + 321 WP_081245520.1 hypothetical protein -
N5E84_RS19845 (N5E84_19845) 873025..873378 + 354 WP_069212062.1 IS66 family insertion sequence element accessory protein TnpB -
N5E84_RS19850 (N5E84_19850) 873438..874970 + 1533 WP_069212063.1 IS66-like element ISVa9 family transposase -
N5E84_RS19855 (N5E84_19855) 875164..876366 - 1203 WP_029388116.1 DUF3800 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 850134..914576 64442
- inside IScluster/Tn - - 865207..911384 46177
- inside Integron - - 837523..869844 32321


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-92)

Antitoxin

Antitoxin ParD

(1-78)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11662.38 Da        Isoelectric Point: 9.8917

>T258432 WP_019282621.1 NZ_CP104555:871387-871686 [Vibrio sp. J502]
MKPFQLTNKAKSDLKDIALFTSRRWGREQRNIYLKQFDESFWLLAENPDIGKTCDEIRDGYRKFPQGSHVIFYQQIGSQN
IQIIRILHKSMDVNPIFGA

Download         Length: 300 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8946.90 Da        Isoelectric Point: 4.3085

>AT258432 WP_019282620.1 NZ_CP104555:871148-871390 [Vibrio sp. J502]
MAKNTSITLGDHFDGFISSQIQSGRYGSASEVIRSALRLLETQETKMNTLRQLLVEGEESGMADYDLNSFISELDSEERK

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7X8U0Q7

Antitoxin

Source ID Structure
AlphaFold DB A0A289GHF4

References