Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 871148..871686 | Replicon | chromosome |
| Accession | NZ_CP104555 | ||
| Organism | Vibrio sp. J502 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A7X8U0Q7 |
| Locus tag | N5E84_RS19830 | Protein ID | WP_019282621.1 |
| Coordinates | 871387..871686 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A289GHF4 |
| Locus tag | N5E84_RS19825 | Protein ID | WP_019282620.1 |
| Coordinates | 871148..871390 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5E84_RS19800 (N5E84_19800) | 866291..866668 | - | 378 | WP_019283451.1 | hypothetical protein | - |
| N5E84_RS19805 (N5E84_19805) | 866718..866828 | - | 111 | Protein_789 | DUF3265 domain-containing protein | - |
| N5E84_RS19810 (N5E84_19810) | 866825..867538 | - | 714 | WP_019283452.1 | Fic family protein | - |
| N5E84_RS19815 (N5E84_19815) | 869329..869844 | - | 516 | WP_019283453.1 | peptide deformylase | - |
| N5E84_RS19820 (N5E84_19820) | 870085..871053 | + | 969 | WP_081245536.1 | IS30 family transposase | - |
| N5E84_RS19825 (N5E84_19825) | 871148..871390 | + | 243 | WP_019282620.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| N5E84_RS19830 (N5E84_19830) | 871387..871686 | + | 300 | WP_019282621.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5E84_RS19835 (N5E84_19835) | 871737..872626 | - | 890 | Protein_795 | IS256 family transposase | - |
| N5E84_RS19840 (N5E84_19840) | 872708..873028 | + | 321 | WP_081245520.1 | hypothetical protein | - |
| N5E84_RS19845 (N5E84_19845) | 873025..873378 | + | 354 | WP_069212062.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| N5E84_RS19850 (N5E84_19850) | 873438..874970 | + | 1533 | WP_069212063.1 | IS66-like element ISVa9 family transposase | - |
| N5E84_RS19855 (N5E84_19855) | 875164..876366 | - | 1203 | WP_029388116.1 | DUF3800 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 850134..914576 | 64442 | |
| - | inside | IScluster/Tn | - | - | 865207..911384 | 46177 | |
| - | inside | Integron | - | - | 837523..869844 | 32321 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11662.38 Da Isoelectric Point: 9.8917
>T258432 WP_019282621.1 NZ_CP104555:871387-871686 [Vibrio sp. J502]
MKPFQLTNKAKSDLKDIALFTSRRWGREQRNIYLKQFDESFWLLAENPDIGKTCDEIRDGYRKFPQGSHVIFYQQIGSQN
IQIIRILHKSMDVNPIFGA
MKPFQLTNKAKSDLKDIALFTSRRWGREQRNIYLKQFDESFWLLAENPDIGKTCDEIRDGYRKFPQGSHVIFYQQIGSQN
IQIIRILHKSMDVNPIFGA
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7X8U0Q7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A289GHF4 |