Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /GNAT-DUF1778 |
| Location | 864284..865050 | Replicon | chromosome |
| Accession | NZ_CP104555 | ||
| Organism | Vibrio sp. J502 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A290PTK1 |
| Locus tag | N5E84_RS19785 | Protein ID | WP_017045788.1 |
| Coordinates | 864553..865050 (+) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A290Q6J3 |
| Locus tag | N5E84_RS19780 | Protein ID | WP_019283269.1 |
| Coordinates | 864284..864556 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5E84_RS19750 (N5E84_19750) | 860164..860325 | + | 162 | Protein_778 | IS30 family transposase | - |
| N5E84_RS19755 (N5E84_19755) | 860361..860708 | - | 348 | WP_019283292.1 | SH3 domain-containing protein | - |
| N5E84_RS19760 (N5E84_19760) | 860859..861380 | - | 522 | WP_019283291.1 | GNAT family N-acetyltransferase | - |
| N5E84_RS19765 (N5E84_19765) | 861524..861974 | - | 451 | Protein_781 | GyrI-like domain-containing protein | - |
| N5E84_RS19770 (N5E84_19770) | 863115..863534 | - | 420 | WP_069212067.1 | hypothetical protein | - |
| N5E84_RS19775 (N5E84_19775) | 864083..864244 | - | 162 | WP_019283270.1 | DUF3265 domain-containing protein | - |
| N5E84_RS19780 (N5E84_19780) | 864284..864556 | + | 273 | WP_019283269.1 | DUF1778 domain-containing protein | Antitoxin |
| N5E84_RS19785 (N5E84_19785) | 864553..865050 | + | 498 | WP_017045788.1 | GNAT family N-acetyltransferase | Toxin |
| N5E84_RS19790 (N5E84_19790) | 865084..865203 | - | 120 | Protein_786 | DUF3265 domain-containing protein | - |
| N5E84_RS19795 (N5E84_19795) | 865207..866175 | - | 969 | WP_081245536.1 | IS30 family transposase | - |
| N5E84_RS19800 (N5E84_19800) | 866291..866668 | - | 378 | WP_019283451.1 | hypothetical protein | - |
| N5E84_RS19805 (N5E84_19805) | 866718..866828 | - | 111 | Protein_789 | DUF3265 domain-containing protein | - |
| N5E84_RS19810 (N5E84_19810) | 866825..867538 | - | 714 | WP_019283452.1 | Fic family protein | - |
| N5E84_RS19815 (N5E84_19815) | 869329..869844 | - | 516 | WP_019283453.1 | peptide deformylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 850134..914576 | 64442 | |
| - | inside | IScluster/Tn | - | - | 865207..911384 | 46177 | |
| - | inside | Integron | - | - | 837523..869844 | 32321 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18524.30 Da Isoelectric Point: 9.2813
>T258431 WP_017045788.1 NZ_CP104555:864553-865050 [Vibrio sp. J502]
MMKTVLLDKDKHDRNRFNCGIDALNNYLKVMASQQAKKDNTRTFVLEDENNTSLIIGFYTLTMTPIDLKTLPDKLQKKHQ
SSTSGGLIARLAIDDSYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFKAFQDAENKLFITISDI
RASLG
MMKTVLLDKDKHDRNRFNCGIDALNNYLKVMASQQAKKDNTRTFVLEDENNTSLIIGFYTLTMTPIDLKTLPDKLQKKHQ
SSTSGGLIARLAIDDSYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFKAFQDAENKLFITISDI
RASLG
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A290PTK1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A290Q6J3 |