Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 853476..854035 Replicon chromosome
Accession NZ_CP104555
Organism Vibrio sp. J502

Toxin (Protein)


Gene name relE Uniprot ID F7YRQ7
Locus tag N5E84_RS19705 Protein ID WP_010320663.1
Coordinates 853757..854035 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A233HRF0
Locus tag N5E84_RS19700 Protein ID WP_017040620.1
Coordinates 853476..853760 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5E84_RS19660 (N5E84_19660) 849241..849657 - 417 WP_017045395.1 VOC family protein -
N5E84_RS19665 (N5E84_19665) 849699..849809 - 111 WP_232513712.1 DUF3265 domain-containing protein -
N5E84_RS19670 (N5E84_19670) 849806..850123 - 318 WP_001232701.1 HigA family addiction module antitoxin -
N5E84_RS19675 (N5E84_19675) 850134..850421 - 288 WP_029388214.1 type II toxin-antitoxin system RelE/ParE family toxin -
N5E84_RS19680 (N5E84_19680) 850725..850955 + 231 WP_013868597.1 PAS factor family protein -
N5E84_RS19685 (N5E84_19685) 851075..851269 - 195 WP_081317735.1 DUF1289 domain-containing protein -
N5E84_RS19690 (N5E84_19690) 851316..852466 + 1151 WP_095661212.1 IS3 family transposase -
N5E84_RS19695 (N5E84_19695) 852773..853224 - 452 Protein_767 lipocalin family protein -
N5E84_RS19700 (N5E84_19700) 853476..853760 + 285 WP_017040620.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
N5E84_RS19705 (N5E84_19705) 853757..854035 + 279 WP_010320663.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
N5E84_RS19710 (N5E84_19710) 854064..854180 - 117 WP_094145943.1 DUF3265 domain-containing protein -
N5E84_RS19715 (N5E84_19715) 854177..854656 - 480 WP_017045717.1 lecithin retinol acyltransferase family protein -
N5E84_RS19720 (N5E84_19720) 855566..856059 + 494 Protein_772 type VI secretion system tube protein Hcp -
N5E84_RS19725 (N5E84_19725) 856052..856837 + 786 WP_019283218.1 DUF4225 domain-containing protein -
N5E84_RS19730 (N5E84_19730) 857493..857786 + 294 Protein_774 helix-turn-helix domain-containing protein -
N5E84_RS19735 (N5E84_19735) 857869..858189 + 321 WP_019283194.1 hypothetical protein -
N5E84_RS19740 (N5E84_19740) 858186..858539 + 354 WP_019283195.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 850134..914576 64442
- inside IScluster/Tn - - 830576..852466 21890
- inside Integron - - 837523..869844 32321


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-44)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10878.58 Da        Isoelectric Point: 4.3430

>T258430 WP_010320663.1 NZ_CP104555:853757-854035 [Vibrio sp. J502]
MILWEEESLNDREKIFEFLYDFNPDAAEKTDDIIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVEGSIIRIM
RVLHQKQKFPTD

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10957.29 Da        Isoelectric Point: 9.2173

>AT258430 WP_017040620.1 NZ_CP104555:853476-853760 [Vibrio sp. J502]
MDTRIQFRVDDEIKRLAQQMAESQGRTLSDACRELTEQMAEQQRKTLSHDAWLTEQINLAFEKFDSGKSSFVEHNSAKAR
MAERKAKIRNRGQQ

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0F2IQF3

Antitoxin

Source ID Structure
AlphaFold DB A0A233HRF0

References