Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-yefM/YoeB-RelB
Location 844173..844683 Replicon chromosome
Accession NZ_CP104555
Organism Vibrio sp. J502

Toxin (Protein)


Gene name relB Uniprot ID A0A289GH26
Locus tag N5E84_RS19615 Protein ID WP_009836584.1
Coordinates 844173..844436 (-) Length 88 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID A0A7T0WJM7
Locus tag N5E84_RS19620 Protein ID WP_019283323.1
Coordinates 844429..844683 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5E84_RS19595 (N5E84_19595) 841350..841442 - 93 WP_140286978.1 DUF3265 domain-containing protein -
N5E84_RS19600 (N5E84_19600) 841663..842634 + 972 WP_019282910.1 IS110 family transposase -
N5E84_RS19605 (N5E84_19605) 842642..842815 - 174 Protein_749 GNAT family N-acetyltransferase -
N5E84_RS19610 (N5E84_19610) 842914..843882 + 969 WP_095661356.1 IS30 family transposase -
N5E84_RS19615 (N5E84_19615) 844173..844436 - 264 WP_009836584.1 Txe/YoeB family addiction module toxin Toxin
N5E84_RS19620 (N5E84_19620) 844429..844683 - 255 WP_019283323.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
N5E84_RS19625 (N5E84_19625) 844985..846517 - 1533 WP_069212063.1 IS66-like element ISVa9 family transposase -
N5E84_RS19630 (N5E84_19630) 846577..846930 - 354 WP_069212062.1 IS66 family insertion sequence element accessory protein TnpB -
N5E84_RS19635 (N5E84_19635) 846927..847247 - 321 WP_081245520.1 hypothetical protein -
N5E84_RS19640 (N5E84_19640) 847331..847684 + 354 Protein_756 transposase -
N5E84_RS19645 (N5E84_19645) 847691..847924 - 234 WP_116285044.1 hypothetical protein -
N5E84_RS19650 (N5E84_19650) 847944..848066 - 123 WP_199731798.1 DUF3265 domain-containing protein -
N5E84_RS19655 (N5E84_19655) 848257..849228 + 972 WP_019282910.1 IS110 family transposase -
N5E84_RS19660 (N5E84_19660) 849241..849657 - 417 WP_017045395.1 VOC family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 830576..852466 21890
- inside Integron - - 837523..869844 32321


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(8-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10302.63 Da        Isoelectric Point: 8.8578

>T258428 WP_009836584.1 NZ_CP104555:c844436-844173 [Vibrio sp. J502]
MSSRLLSWTDESWNDYVYWQTQDKKTLKRINKLITDAKRSPFEGIGKPEPLKENLSGFWSRRIDDANRLVYAVDDSAITI
ISCRYHY

Download         Length: 264 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9434.60 Da        Isoelectric Point: 5.5802

>AT258428 WP_019283323.1 NZ_CP104555:c844683-844429 [Vibrio sp. J502]
MRIVSFTEARNSLKSVLDAVVNDADTTVITRRDSEDAVVMSLDYYNSLMETVHLLRSPANAEHLHRSIAQFKAGKASQRD
LIDE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A289GH26

Antitoxin

Source ID Structure
AlphaFold DB A0A7T0WJM7

References