Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-YefM
Location 786145..786694 Replicon chromosome
Accession NZ_CP104555
Organism Vibrio sp. J502

Toxin (Protein)


Gene name parE Uniprot ID A0A191WAE5
Locus tag N5E84_RS19280 Protein ID WP_017049509.1
Coordinates 786395..786694 (+) Length 100 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A233HQC6
Locus tag N5E84_RS19275 Protein ID WP_017045808.1
Coordinates 786145..786387 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5E84_RS19250 (N5E84_19250) 781486..782433 - 948 WP_038148427.1 exopolyphosphatase -
N5E84_RS19255 (N5E84_19255) 782749..783369 - 621 WP_019282470.1 ATP-dependent zinc protease -
N5E84_RS19260 (N5E84_19260) 783398..784579 - 1182 WP_019282469.1 amino acid aminotransferase -
N5E84_RS19265 (N5E84_19265) 784642..784722 - 81 Protein_681 anaerobic ribonucleoside-triphosphate reductase-activating protein -
N5E84_RS19275 (N5E84_19275) 786145..786387 + 243 WP_017045808.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N5E84_RS19280 (N5E84_19280) 786395..786694 + 300 WP_017049509.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5E84_RS19285 (N5E84_19285) 786862..787326 - 465 WP_017046620.1 GNAT family N-acetyltransferase -
N5E84_RS19290 (N5E84_19290) 787815..787931 - 117 Protein_686 DUF3265 domain-containing protein -
N5E84_RS19295 (N5E84_19295) 787922..788395 - 474 WP_019282174.1 GNAT family N-acetyltransferase -
N5E84_RS19300 (N5E84_19300) 788536..788997 - 462 WP_232513707.1 lipocalin family protein -
N5E84_RS19305 (N5E84_19305) 789186..789503 - 318 WP_069212157.1 dihydrofolate reductase family protein -
N5E84_RS19310 (N5E84_19310) 789637..790605 + 969 WP_081245537.1 IS30-like element ISVa6 family transposase -
N5E84_RS19315 (N5E84_19315) 790537..791004 - 468 WP_232513706.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 784752..825315 40563


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-47)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11412.09 Da        Isoelectric Point: 9.8456

>T258427 WP_017049509.1 NZ_CP104555:786395-786694 [Vibrio sp. J502]
MHKSKYKLSKLAQAHLHKIKNYTVTNFSEMQWNAYKDTLLTGFQMLADNPAVGRSCNDLYQNGFYFPIGKHTAYFTKEDS
FILVVAVLGQSQLPQNHLR

Download         Length: 300 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9036.28 Da        Isoelectric Point: 4.7672

>AT258427 WP_017045808.1 NZ_CP104555:786145-786387 [Vibrio sp. J502]
MYTLTANDAKRNFGELLLNAQREPVKISKNNKDAVVVMSIRDYEELEVMKADYIKHCFESAKADLAQGNIVDGENFLNAL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A191WAE5

Antitoxin

Source ID Structure
AlphaFold DB A0A233HQC6

References