Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /DUF1778(antitoxin) |
| Location | 680114..681066 | Replicon | chromosome |
| Accession | NZ_CP104555 | ||
| Organism | Vibrio sp. J502 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A7U5NDE7 |
| Locus tag | N5E84_RS18740 | Protein ID | WP_069211914.1 |
| Coordinates | 680533..681066 (+) | Length | 178 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | N5E84_RS18735 | Protein ID | WP_164732805.1 |
| Coordinates | 680114..680536 (+) | Length | 141 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5E84_RS18710 (N5E84_18710) | 675294..675734 | + | 441 | WP_029190018.1 | hypothetical protein | - |
| N5E84_RS18715 (N5E84_18715) | 675748..676719 | - | 972 | WP_019282910.1 | IS110 family transposase | - |
| N5E84_RS18725 (N5E84_18725) | 678433..679508 | - | 1076 | Protein_574 | IS3 family transposase | - |
| N5E84_RS18730 (N5E84_18730) | 679569..679735 | + | 167 | Protein_575 | IS4 family transposase | - |
| N5E84_RS18735 (N5E84_18735) | 680114..680536 | + | 423 | WP_164732805.1 | DUF1778 domain-containing protein | Antitoxin |
| N5E84_RS18740 (N5E84_18740) | 680533..681066 | + | 534 | WP_069211914.1 | GNAT family N-acetyltransferase | Toxin |
| N5E84_RS18745 (N5E84_18745) | 681272..682192 | + | 921 | WP_069211915.1 | hypothetical protein | - |
| N5E84_RS18750 (N5E84_18750) | 682250..682660 | - | 411 | Protein_579 | IS30 family transposase | - |
| N5E84_RS18755 (N5E84_18755) | 682725..683875 | + | 1151 | WP_095661380.1 | IS3 family transposase | - |
| N5E84_RS18760 (N5E84_18760) | 683972..684208 | + | 237 | Protein_581 | gcrA cell cycle regulator family protein | - |
| N5E84_RS18765 (N5E84_18765) | 684205..684489 | + | 285 | WP_069212144.1 | hypothetical protein | - |
| N5E84_RS18770 (N5E84_18770) | 684759..685070 | - | 312 | WP_019282715.1 | stress response translation initiation inhibitor YciH | - |
| N5E84_RS18775 (N5E84_18775) | 685078..685449 | - | 372 | WP_013867787.1 | DUF3319 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 663202..709360 | 46158 | |
| - | inside | IScluster/Tn | - | - | 654687..683875 | 29188 | |
| - | inside | Integron | - | - | 660108..675734 | 15626 | |
| - | inside | Integron | - | - | 680041..682192 | 2151 | |
| - | inside | Prophage | - | - | 663202..716369 | 53167 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 20293.67 Da Isoelectric Point: 9.3517
>T258426 WP_069211914.1 NZ_CP104555:680533-681066 [Vibrio sp. J502]
VSWGKEFVELSKSKHDRDSFDCGEQELNTFIKTQAAKRMQAGISRTMVLPSAQPLLNQKFAICVFYSVAPSSISRETLPA
QLAKKLPRYPIPVFLLAQLAVHKEYHGSGLGKISLIRALKYLWEVNHHMRVYAIVVDCLTDSAQAFYTKFGFEVLCEYNE
RIRMFLPMKTVEQLFNQ
VSWGKEFVELSKSKHDRDSFDCGEQELNTFIKTQAAKRMQAGISRTMVLPSAQPLLNQKFAICVFYSVAPSSISRETLPA
QLAKKLPRYPIPVFLLAQLAVHKEYHGSGLGKISLIRALKYLWEVNHHMRVYAIVVDCLTDSAQAFYTKFGFEVLCEYNE
RIRMFLPMKTVEQLFNQ
Download Length: 534 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 15816.26 Da Isoelectric Point: 6.4738
>AT258426 WP_164732805.1 NZ_CP104555:680114-680536 [Vibrio sp. J502]
VYFLSSAVRWQPLSRALYSLSFRKFSVLIEYALSLHYNQSAYGTYPYIGGVMATARLDIRLDEEIKAKAEKASALLGLKS
LTEYVVRLMDEDATHVIEEYESIMVKDSVFDEFMAACNKVKAPNQALLEAVKFTEKSGIK
VYFLSSAVRWQPLSRALYSLSFRKFSVLIEYALSLHYNQSAYGTYPYIGGVMATARLDIRLDEEIKAKAEKASALLGLKS
LTEYVVRLMDEDATHVIEEYESIMVKDSVFDEFMAACNKVKAPNQALLEAVKFTEKSGIK
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|