Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 660251..660791 Replicon chromosome
Accession NZ_CP104555
Organism Vibrio sp. J502

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag N5E84_RS18615 Protein ID WP_019283192.1
Coordinates 660251..660463 (-) Length 71 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A233HK77
Locus tag N5E84_RS18620 Protein ID WP_019283191.1
Coordinates 660513..660791 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5E84_RS18585 (N5E84_18585) 655263..655616 + 354 WP_019283195.1 IS66 family insertion sequence element accessory protein TnpB -
N5E84_RS18590 (N5E84_18590) 655676..657208 + 1533 WP_069211897.1 IS66-like element ISVa11 family transposase -
N5E84_RS18595 (N5E84_18595) 657242..657352 + 111 Protein_548 transposase -
N5E84_RS18600 (N5E84_18600) 657374..658906 - 1533 WP_069212063.1 IS66-like element ISVa9 family transposase -
N5E84_RS18605 (N5E84_18605) 658966..659319 - 354 WP_069212062.1 IS66 family insertion sequence element accessory protein TnpB -
N5E84_RS18610 (N5E84_18610) 659316..659636 - 321 WP_081245520.1 hypothetical protein -
N5E84_RS18615 (N5E84_18615) 660251..660463 - 213 WP_019283192.1 type II toxin-antitoxin system YafQ family toxin Toxin
N5E84_RS18620 (N5E84_18620) 660513..660791 - 279 WP_019283191.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
N5E84_RS18625 (N5E84_18625) 660848..660958 + 111 WP_094164944.1 DUF3265 domain-containing protein -
N5E84_RS18630 (N5E84_18630) 661058..661294 - 237 WP_013867767.1 hypothetical protein -
N5E84_RS18635 (N5E84_18635) 662081..662494 + 414 WP_019283386.1 RDD family protein -
N5E84_RS18640 (N5E84_18640) 662697..663167 + 471 WP_019282925.1 hypothetical protein -
N5E84_RS18645 (N5E84_18645) 663202..664170 - 969 WP_081245536.1 IS30 family transposase -
N5E84_RS18650 (N5E84_18650) 664285..664377 + 93 WP_140288197.1 DUF3265 domain-containing protein -
N5E84_RS18655 (N5E84_18655) 664426..664833 + 408 WP_175418697.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 663202..709360 46158
- inside IScluster/Tn - - 654687..683875 29188
- inside Integron - - 660108..675734 15626
- inside Prophage - - 663202..716369 53167


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(6-70)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(3-84)


Sequences

Toxin        


Download         Length: 71 a.a.        Molecular weight: 7869.10 Da        Isoelectric Point: 6.7122

>T258425 WP_019283192.1 NZ_CP104555:c660463-660251 [Vibrio sp. J502]
MPISDIIEVGNVISKLQRGEKLDPKNVDHPLTGGWVGFRDCHVKPDLVLIYRIFDGQLQLARIGSHSDLF

Download         Length: 213 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 9995.47 Da        Isoelectric Point: 6.4761

>AT258425 WP_019283191.1 NZ_CP104555:c660791-660513 [Vibrio sp. J502]
MRTEMLSTRIDHDTKVAFTSICDEMGLSTSQAIKIFAKAVINHGGIPFDLRVPQPNETTISAMNELVQGHGHKAESVGAM
LTELTEGKVKNV

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A233HK77

References