Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4834094..4834610 | Replicon | chromosome |
Accession | NZ_CP104551 | ||
Organism | Klebsiella pneumoniae strain K28074 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2XDK6 |
Locus tag | N5911_RS24005 | Protein ID | WP_002886902.1 |
Coordinates | 4834094..4834378 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | N5911_RS24010 | Protein ID | WP_002886901.1 |
Coordinates | 4834368..4834610 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5911_RS23980 (N5911_23980) | 4829578..4829841 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
N5911_RS23985 (N5911_23985) | 4829971..4830144 | + | 174 | WP_002886906.1 | hypothetical protein | - |
N5911_RS23990 (N5911_23990) | 4830147..4830890 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
N5911_RS23995 (N5911_23995) | 4831247..4833385 | + | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
N5911_RS24000 (N5911_24000) | 4833626..4834090 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
N5911_RS24005 (N5911_24005) | 4834094..4834378 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5911_RS24010 (N5911_24010) | 4834368..4834610 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N5911_RS24015 (N5911_24015) | 4834688..4836598 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
N5911_RS24020 (N5911_24020) | 4836621..4837775 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
N5911_RS24025 (N5911_24025) | 4837841..4838581 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T258421 WP_002886902.1 NZ_CP104551:c4834378-4834094 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GMH2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |