Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4118111..4118730 Replicon chromosome
Accession NZ_CP104551
Organism Klebsiella pneumoniae strain K28074

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag N5911_RS20565 Protein ID WP_002892050.1
Coordinates 4118512..4118730 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag N5911_RS20560 Protein ID WP_002892066.1
Coordinates 4118111..4118485 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5911_RS20550 (N5911_20550) 4113263..4114456 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
N5911_RS20555 (N5911_20555) 4114479..4117625 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
N5911_RS20560 (N5911_20560) 4118111..4118485 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
N5911_RS20565 (N5911_20565) 4118512..4118730 + 219 WP_002892050.1 HHA domain-containing protein Toxin
N5911_RS20570 (N5911_20570) 4118889..4119455 + 567 WP_002892030.1 maltose O-acetyltransferase -
N5911_RS20575 (N5911_20575) 4119427..4119567 - 141 WP_004147370.1 hypothetical protein -
N5911_RS20580 (N5911_20580) 4119588..4120058 + 471 WP_002892026.1 YlaC family protein -
N5911_RS20585 (N5911_20585) 4120033..4121484 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
N5911_RS20590 (N5911_20590) 4121585..4122283 + 699 WP_002892021.1 GNAT family protein -
N5911_RS20595 (N5911_20595) 4122280..4122420 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
N5911_RS20600 (N5911_20600) 4122420..4122683 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T258419 WP_002892050.1 NZ_CP104551:4118512-4118730 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT258419 WP_002892066.1 NZ_CP104551:4118111-4118485 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References