Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 721866..722521 | Replicon | chromosome |
Accession | NZ_CP104548 | ||
Organism | Neisseria gonorrhoeae strain 10538 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | NDL69_RS03865 | Protein ID | WP_003691083.1 |
Coordinates | 722102..722521 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | NDL69_RS03860 | Protein ID | WP_003688410.1 |
Coordinates | 721866..722102 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDL69_RS03830 (NDL69_03835) | 717000..717287 | + | 288 | WP_003688407.1 | hypothetical protein | - |
NDL69_RS03835 (NDL69_03840) | 717359..718525 | + | 1167 | WP_003688408.1 | ADP-forming succinate--CoA ligase subunit beta | - |
NDL69_RS03840 (NDL69_03845) | 718536..719426 | + | 891 | WP_002244992.1 | succinate--CoA ligase subunit alpha | - |
NDL69_RS03845 (NDL69_03850) | 719809..720195 | - | 387 | Protein_747 | IS110 family transposase | - |
NDL69_RS03850 (NDL69_03855) | 720434..720835 | + | 402 | WP_020997339.1 | helix-turn-helix domain-containing protein | - |
NDL69_RS03855 (NDL69_03860) | 720840..721418 | + | 579 | WP_003688041.1 | IS3 family transposase | - |
NDL69_RS03860 (NDL69_03865) | 721866..722102 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
NDL69_RS03865 (NDL69_03870) | 722102..722521 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
NDL69_RS03870 (NDL69_03875) | 722670..724124 | - | 1455 | WP_003701282.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
NDL69_RS03875 (NDL69_03880) | 724121..724822 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
NDL69_RS03880 (NDL69_03885) | 724819..725598 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
NDL69_RS03885 (NDL69_03890) | 725746..727287 | + | 1542 | WP_003697015.1 | MDR family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 719743..720216 | 473 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T258408 WP_003691083.1 NZ_CP104548:722102-722521 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|