Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1862587..1863272 | Replicon | chromosome |
| Accession | NZ_CP104546 | ||
| Organism | Neisseria gonorrhoeae strain 9035 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | NDL71_RS09990 | Protein ID | WP_003689143.1 |
| Coordinates | 1862587..1862769 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | NDL71_RS09995 | Protein ID | WP_003691454.1 |
| Coordinates | 1862871..1863272 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDL71_RS09955 (NDL71_06330) | 1857593..1858492 | - | 900 | WP_050154374.1 | replication protein | - |
| NDL71_RS09960 (NDL71_06335) | 1858689..1858889 | - | 201 | WP_012503750.1 | hypothetical protein | - |
| NDL71_RS09965 (NDL71_06340) | 1858891..1859025 | - | 135 | WP_229684436.1 | YdaS family helix-turn-helix protein | - |
| NDL71_RS09970 (NDL71_06345) | 1859274..1859927 | + | 654 | WP_157149898.1 | helix-turn-helix transcriptional regulator | - |
| NDL71_RS09975 (NDL71_06350) | 1859967..1860665 | + | 699 | WP_002212401.1 | S24 family peptidase | - |
| NDL71_RS09980 (NDL71_06355) | 1860904..1861602 | + | 699 | WP_003689139.1 | hypothetical protein | - |
| NDL71_RS09985 (NDL71_06360) | 1861599..1862417 | + | 819 | WP_012503752.1 | DUF3037 domain-containing protein | - |
| NDL71_RS09990 (NDL71_06365) | 1862587..1862769 | + | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NDL71_RS09995 (NDL71_06370) | 1862871..1863272 | + | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NDL71_RS10000 (NDL71_06375) | 1863371..1864132 | - | 762 | WP_012503753.1 | hypothetical protein | - |
| NDL71_RS10005 (NDL71_06380) | 1864353..1864553 | + | 201 | WP_003704298.1 | hypothetical protein | - |
| NDL71_RS10010 (NDL71_06385) | 1864586..1865062 | + | 477 | WP_002255718.1 | hypothetical protein | - |
| NDL71_RS10015 (NDL71_06390) | 1865059..1865340 | + | 282 | WP_262668621.1 | hypothetical protein | - |
| NDL71_RS10020 (NDL71_06395) | 1865481..1865813 | + | 333 | WP_003687946.1 | hypothetical protein | - |
| NDL71_RS10025 (NDL71_06400) | 1865966..1866244 | + | 279 | WP_003691529.1 | hypothetical protein | - |
| NDL71_RS10030 (NDL71_06405) | 1866241..1866402 | + | 162 | WP_003702497.1 | hypothetical protein | - |
| NDL71_RS10035 (NDL71_06410) | 1866471..1867157 | + | 687 | WP_012503754.1 | hypothetical protein | - |
| NDL71_RS10040 (NDL71_06415) | 1867297..1867479 | + | 183 | WP_003691535.1 | hypothetical protein | - |
| NDL71_RS10045 (NDL71_06420) | 1867476..1867967 | + | 492 | WP_003691537.1 | siphovirus Gp157 family protein | - |
| NDL71_RS10050 (NDL71_06425) | 1868019..1868234 | + | 216 | WP_003691538.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1823968..1884374 | 60406 | |
| - | inside | Prophage | - | - | 1823968..1886859 | 62891 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T258406 WP_003689143.1 NZ_CP104546:1862587-1862769 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT258406 WP_003691454.1 NZ_CP104546:1862871-1863272 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|