Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 1378789..1379444 | Replicon | chromosome |
| Accession | NZ_CP104546 | ||
| Organism | Neisseria gonorrhoeae strain 9035 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q5F882 |
| Locus tag | NDL71_RS07515 | Protein ID | WP_003691083.1 |
| Coordinates | 1379025..1379444 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q5F881 |
| Locus tag | NDL71_RS07510 | Protein ID | WP_003688410.1 |
| Coordinates | 1378789..1379025 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDL71_RS07480 (NDL71_03855) | 1373923..1374210 | + | 288 | WP_003688407.1 | hypothetical protein | - |
| NDL71_RS07485 (NDL71_03860) | 1374282..1375448 | + | 1167 | WP_003688408.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| NDL71_RS07490 (NDL71_03865) | 1375459..1376349 | + | 891 | WP_002244992.1 | succinate--CoA ligase subunit alpha | - |
| NDL71_RS07495 (NDL71_03870) | 1376732..1377118 | - | 387 | Protein_1442 | IS110 family transposase | - |
| NDL71_RS07500 (NDL71_03875) | 1377357..1377758 | + | 402 | WP_020997339.1 | helix-turn-helix domain-containing protein | - |
| NDL71_RS07505 (NDL71_03880) | 1377763..1378341 | + | 579 | WP_003688041.1 | IS3 family transposase | - |
| NDL71_RS07510 (NDL71_03885) | 1378789..1379025 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
| NDL71_RS07515 (NDL71_03890) | 1379025..1379444 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
| NDL71_RS07520 (NDL71_03895) | 1379593..1381047 | - | 1455 | WP_003701282.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| NDL71_RS07525 (NDL71_03900) | 1381044..1381745 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
| NDL71_RS07530 (NDL71_03905) | 1381742..1382521 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
| NDL71_RS07535 (NDL71_03910) | 1382669..1384210 | + | 1542 | WP_003697015.1 | MDR family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1376666..1377139 | 473 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T258405 WP_003691083.1 NZ_CP104546:1379025-1379444 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|