Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 35454..35979 | Replicon | plasmid p2 |
Accession | NZ_CP104541 | ||
Organism | Escherichia coli strain E6 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | N5O76_RS24820 | Protein ID | WP_001159871.1 |
Coordinates | 35454..35759 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | Q3ZU16 |
Locus tag | N5O76_RS24825 | Protein ID | WP_000813639.1 |
Coordinates | 35761..35979 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O76_RS24790 (31450) | 31450..31623 | + | 174 | Protein_33 | DUF4113 domain-containing protein | - |
N5O76_RS24795 (31625) | 31625..32041 | - | 417 | WP_001278818.1 | plasmid partitioning/stability family protein | - |
N5O76_RS24800 (32034) | 32034..33014 | - | 981 | WP_000688514.1 | plasmid segregation protein ParM | - |
N5O76_RS24805 (33428) | 33428..33736 | - | 309 | WP_000030199.1 | hypothetical protein | - |
N5O76_RS24810 (33823) | 33823..34467 | - | 645 | WP_001144036.1 | ParA family protein | - |
N5O76_RS24815 (34647) | 34647..35453 | - | 807 | WP_033904598.1 | site-specific integrase | - |
N5O76_RS24820 (35454) | 35454..35759 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
N5O76_RS24825 (35761) | 35761..35979 | - | 219 | WP_000813639.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
N5O76_RS24830 (36576) | 36576..36836 | + | 261 | WP_000343102.1 | hypothetical protein | - |
N5O76_RS24835 (36833) | 36833..37423 | + | 591 | WP_000194555.1 | hypothetical protein | - |
N5O76_RS24840 (37441) | 37441..37788 | - | 348 | WP_000142424.1 | DUF6404 family protein | - |
N5O76_RS24845 (37907) | 37907..38254 | + | 348 | WP_000762580.1 | colicin E1 family microcin immunity protein | - |
N5O76_RS24850 (38272) | 38272..39897 | - | 1626 | WP_001456214.1 | colicin Ia central receptor-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sul1 / qacE / aac(3)-VIa / ant(3'')-Ia | - | 1..114993 | 114993 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T258400 WP_001159871.1 NZ_CP104541:c35759-35454 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9DIR5 |