Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 106192..106817 | Replicon | plasmid p1 |
Accession | NZ_CP104540 | ||
Organism | Escherichia coli strain E6 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N5O76_RS24170 | Protein ID | WP_000911333.1 |
Coordinates | 106419..106817 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | N5O76_RS24165 | Protein ID | WP_000450520.1 |
Coordinates | 106192..106419 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O76_RS24165 (106192) | 106192..106419 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
N5O76_RS24170 (106419) | 106419..106817 | + | 399 | WP_000911333.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
N5O76_RS24175 (106826) | 106826..108979 | - | 2154 | WP_000009325.1 | type IV conjugative transfer system coupling protein TraD | - |
N5O76_RS24180 (109232) | 109232..109963 | - | 732 | WP_000850422.1 | conjugal transfer complement resistance protein TraT | - |
N5O76_RS24185 (109977) | 109977..110486 | - | 510 | WP_096965639.1 | conjugal transfer entry exclusion protein TraS | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..182456 | 182456 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14919.19 Da Isoelectric Point: 7.8605
>T258395 WP_000911333.1 NZ_CP104540:106419-106817 [Escherichia coli]
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|