Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 83636..84279 | Replicon | plasmid p1 |
Accession | NZ_CP104540 | ||
Organism | Escherichia coli strain E6 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | N5O76_RS24065 | Protein ID | WP_001034044.1 |
Coordinates | 83863..84279 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | N5O76_RS24060 | Protein ID | WP_001261286.1 |
Coordinates | 83636..83866 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O76_RS24035 (79144) | 79144..79971 | + | 828 | WP_000154003.1 | HAD-IIB family hydrolase | - |
N5O76_RS24040 (79974) | 79974..80990 | + | 1017 | WP_000583428.1 | Gfo/Idh/MocA family oxidoreductase | - |
N5O76_RS24045 (80992) | 80992..81261 | + | 270 | WP_000379710.1 | SemiSWEET transporter | - |
N5O76_RS24050 (81258) | 81258..82790 | + | 1533 | WP_001017349.1 | NAD(P)-binding domain-containing protein | - |
N5O76_RS24055 (82822) | 82822..83274 | - | 453 | WP_000670960.1 | acyltransferase | - |
N5O76_RS24060 (83636) | 83636..83866 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N5O76_RS24065 (83863) | 83863..84279 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N5O76_RS24070 (84354) | 84354..85919 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
N5O76_RS24075 (85904) | 85904..86926 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..182456 | 182456 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T258389 WP_001034044.1 NZ_CP104540:83863-84279 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |