258388

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 56815..57374 Replicon plasmid p1
Accession NZ_CP104540
Organism Escherichia coli strain E6

Toxin (Protein)


Gene name relE Uniprot ID A0A0H2XJR9
Locus tag N5O76_RS23920 Protein ID WP_000421266.1
Coordinates 56815..57090 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0H2XL20
Locus tag N5O76_RS23925 Protein ID WP_012006537.1
Coordinates 57090..57374 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O76_RS23895 (51835) 51835..52065 + 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin -
N5O76_RS23900 (52062) 52062..52478 + 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin -
N5O76_RS23905 (52640) 52640..54778 - 2139 WP_000350635.1 AAA family ATPase -
N5O76_RS23910 (55136) 55136..56307 + 1172 WP_094284492.1 IS91 family transposase -
N5O76_RS23915 (56470) 56470..56709 - 240 WP_001105068.1 hypothetical protein -
N5O76_RS23920 (56815) 56815..57090 - 276 WP_000421266.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5O76_RS23925 (57090) 57090..57374 - 285 WP_012006537.1 ribbon-helix-helix domain-containing protein Antitoxin
N5O76_RS23930 (57875) 57875..58066 + 192 Protein_54 recombinase family protein -
N5O76_RS23935 (58133) 58133..58837 + 705 WP_001067858.1 IS6-like element IS26 family transposase -
N5O76_RS23940 (58883) 58883..59293 + 411 Protein_56 recombinase family protein -
N5O76_RS23945 (59340) 59340..59498 + 159 Protein_57 integrase core domain-containing protein -
N5O76_RS23950 (59648) 59648..60646 + 999 WP_000756335.1 ABC transporter substrate-binding protein -
N5O76_RS23955 (60646) 60646..61683 + 1038 WP_000110580.1 iron ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA 1..182456 182456
- inside IScluster/Tn - - 55480..75406 19926


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10779.47 Da        Isoelectric Point: 9.9324

>T258388 WP_000421266.1 NZ_CP104540:c57090-56815 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAATRTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10501.96 Da        Isoelectric Point: 6.4632

>AT258388 WP_012006537.1 NZ_CP104540:c57374-57090 [Escherichia coli]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVKSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H2XJR9

Antitoxin

Source ID Structure
AlphaFold DB A0A0H2XL20

References