258387

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 51835..52478 Replicon plasmid p1
Accession NZ_CP104540
Organism Escherichia coli strain E6

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag N5O76_RS23900 Protein ID WP_001044768.1
Coordinates 52062..52478 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag N5O76_RS23895 Protein ID WP_001261287.1
Coordinates 51835..52065 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O76_RS23860 (47050) 47050..47217 + 168 Protein_40 colicin-B -
N5O76_RS23865 (47235) 47235..47762 - 528 WP_000203272.1 colicin B immunity protein -
N5O76_RS23870 (48006) 48006..48821 + 816 WP_001312845.1 lipid II-degrading bacteriocin colicin M -
N5O76_RS23875 (48871) 48871..49224 - 354 WP_000864812.1 colicin M immunity protein -
N5O76_RS23880 (49402) 49402..50193 - 792 WP_000016494.1 site-specific integrase -
N5O76_RS23885 (50190) 50190..50879 - 690 WP_000796229.1 hypothetical protein -
N5O76_RS23890 (50923) 50923..51273 - 351 WP_000493379.1 hypothetical protein -
N5O76_RS23895 (51835) 51835..52065 + 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N5O76_RS23900 (52062) 52062..52478 + 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
N5O76_RS23905 (52640) 52640..54778 - 2139 WP_000350635.1 AAA family ATPase -
N5O76_RS23910 (55136) 55136..56307 + 1172 WP_094284492.1 IS91 family transposase -
N5O76_RS23915 (56470) 56470..56709 - 240 WP_001105068.1 hypothetical protein -
N5O76_RS23920 (56815) 56815..57090 - 276 WP_000421266.1 type II toxin-antitoxin system RelE/ParE family toxin -
N5O76_RS23925 (57090) 57090..57374 - 285 WP_012006537.1 ribbon-helix-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA 1..182456 182456
- inside IScluster/Tn - - 55480..75406 19926


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T258387 WP_001044768.1 NZ_CP104540:52062-52478 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT258387 WP_001261287.1 NZ_CP104540:51835-52065 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References