Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
| Location | 4230879..4231586 | Replicon | chromosome |
| Accession | NZ_CP104539 | ||
| Organism | Escherichia coli strain E6 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | N5O76_RS20640 | Protein ID | WP_089586169.1 |
| Coordinates | 4230879..4231220 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A8S7X7W3 |
| Locus tag | N5O76_RS20645 | Protein ID | WP_053264533.1 |
| Coordinates | 4231251..4231586 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O76_RS20605 (4226286) | 4226286..4227266 | + | 981 | WP_053264536.1 | sialate O-acetylesterase | - |
| N5O76_RS20610 (4227274) | 4227274..4227924 | - | 651 | WP_001037963.1 | HNH endonuclease | - |
| N5O76_RS20615 (4228061) | 4228061..4228204 | + | 144 | Protein_4035 | HNH endonuclease | - |
| N5O76_RS20620 (4228303) | 4228303..4228488 | + | 186 | WP_000066585.1 | hypothetical protein | - |
| N5O76_RS20625 (4228526) | 4228526..4229473 | - | 948 | WP_000342497.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| N5O76_RS20630 (4229466) | 4229466..4229861 | - | 396 | WP_000152741.1 | DUF6088 family protein | - |
| N5O76_RS20635 (4229931) | 4229931..4230764 | - | 834 | WP_053264535.1 | DUF4942 domain-containing protein | - |
| N5O76_RS20640 (4230879) | 4230879..4231220 | - | 342 | WP_089586169.1 | TA system toxin CbtA family protein | Toxin |
| N5O76_RS20645 (4231251) | 4231251..4231586 | - | 336 | WP_053264533.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N5O76_RS20650 (4231586) | 4231586..4232059 | - | 474 | WP_001296921.1 | DNA repair protein RadC | - |
| N5O76_RS20655 (4232089) | 4232089..4232907 | - | 819 | WP_160347992.1 | DUF932 domain-containing protein | - |
| N5O76_RS20660 (4233143) | 4233143..4234096 | - | 954 | WP_053264531.1 | hypothetical protein | - |
| N5O76_RS20665 (4234689) | 4234689..4235303 | + | 615 | WP_000772910.1 | inovirus Gp2 family protein | - |
| N5O76_RS20670 (4235421) | 4235421..4235639 | + | 219 | WP_001064742.1 | AlpA family phage regulatory protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimC / fimI / fimA / fimE / fimB | 4218853..4249815 | 30962 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13104.13 Da Isoelectric Point: 9.4583
>T258383 WP_089586169.1 NZ_CP104539:c4231220-4230879 [Escherichia coli]
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDTINFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRCYNTTAR
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDTINFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRCYNTTAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|