Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1414566..1415191 | Replicon | chromosome |
Accession | NZ_CP104539 | ||
Organism | Escherichia coli strain E6 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | N5O76_RS06965 | Protein ID | WP_000911329.1 |
Coordinates | 1414793..1415191 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | N5O76_RS06960 | Protein ID | WP_000450524.1 |
Coordinates | 1414566..1414793 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O76_RS06935 (1410368) | 1410368..1410838 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
N5O76_RS06940 (1410838) | 1410838..1411410 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
N5O76_RS06945 (1411556) | 1411556..1412434 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
N5O76_RS06950 (1412451) | 1412451..1413485 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
N5O76_RS06955 (1413698) | 1413698..1414411 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
N5O76_RS06960 (1414566) | 1414566..1414793 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
N5O76_RS06965 (1414793) | 1414793..1415191 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N5O76_RS06970 (1415338) | 1415338..1416201 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
N5O76_RS06975 (1416216) | 1416216..1418231 | + | 2016 | WP_053264617.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
N5O76_RS06980 (1418305) | 1418305..1419003 | + | 699 | WP_000679812.1 | esterase | - |
N5O76_RS06985 (1419084) | 1419084..1419284 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T258372 WP_000911329.1 NZ_CP104539:1414793-1415191 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |