Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1085298..1085881 | Replicon | chromosome |
Accession | NZ_CP104539 | ||
Organism | Escherichia coli strain E6 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U9XFN8 |
Locus tag | N5O76_RS05290 | Protein ID | WP_000254745.1 |
Coordinates | 1085546..1085881 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | N5O76_RS05285 | Protein ID | WP_000581937.1 |
Coordinates | 1085298..1085546 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O76_RS05275 (1081637) | 1081637..1082938 | + | 1302 | WP_021542211.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
N5O76_RS05280 (1082986) | 1082986..1085220 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
N5O76_RS05285 (1085298) | 1085298..1085546 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
N5O76_RS05290 (1085546) | 1085546..1085881 | + | 336 | WP_000254745.1 | endoribonuclease MazF | Toxin |
N5O76_RS05295 (1085952) | 1085952..1086743 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
N5O76_RS05300 (1086971) | 1086971..1088608 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
N5O76_RS05305 (1088696) | 1088696..1089994 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12158.08 Da Isoelectric Point: 8.4777
>T258371 WP_000254745.1 NZ_CP104539:1085546-1085881 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYM3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LMB4 |