Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 911747..912401 | Replicon | chromosome |
| Accession | NZ_CP104539 | ||
| Organism | Escherichia coli strain E6 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | N5O76_RS04530 | Protein ID | WP_000244781.1 |
| Coordinates | 911994..912401 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | N5O76_RS04525 | Protein ID | WP_000354046.1 |
| Coordinates | 911747..912013 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O76_RS04500 (906916) | 906916..907659 | + | 744 | WP_000951951.1 | SDR family oxidoreductase | - |
| N5O76_RS04505 (907716) | 907716..909149 | - | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
| N5O76_RS04510 (909194) | 909194..909505 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| N5O76_RS04515 (909669) | 909669..910328 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| N5O76_RS04520 (910524) | 910524..911504 | - | 981 | WP_000886095.1 | tRNA-modifying protein YgfZ | - |
| N5O76_RS04525 (911747) | 911747..912013 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| N5O76_RS04530 (911994) | 911994..912401 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| N5O76_RS04535 (912441) | 912441..912962 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| N5O76_RS04540 (913074) | 913074..913970 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| N5O76_RS04545 (913995) | 913995..914705 | + | 711 | WP_000715208.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N5O76_RS04550 (914711) | 914711..916444 | + | 1734 | WP_000813218.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T258370 WP_000244781.1 NZ_CP104539:911994-912401 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|