Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 769693..770494 | Replicon | chromosome |
| Accession | NZ_CP104539 | ||
| Organism | Escherichia coli strain E6 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | D8EBK0 |
| Locus tag | N5O76_RS03780 | Protein ID | WP_001094436.1 |
| Coordinates | 769693..770070 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MN76 |
| Locus tag | N5O76_RS03785 | Protein ID | WP_015953067.1 |
| Coordinates | 770117..770494 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O76_RS03755 (765591) | 765591..766127 | + | 537 | WP_053264495.1 | GspM family type II secretion system protein YghD | - |
| N5O76_RS03760 (766463) | 766463..767998 | - | 1536 | WP_000492897.1 | EAL domain-containing protein | - |
| N5O76_RS03765 (768069) | 768069..768914 | - | 846 | WP_001280513.1 | DUF4942 domain-containing protein | - |
| N5O76_RS03770 (768999) | 768999..769196 | - | 198 | WP_000839254.1 | DUF957 domain-containing protein | - |
| N5O76_RS03775 (769208) | 769208..769696 | - | 489 | WP_000761714.1 | DUF5983 family protein | - |
| N5O76_RS03780 (769693) | 769693..770070 | - | 378 | WP_001094436.1 | TA system toxin CbtA family protein | Toxin |
| N5O76_RS03785 (770117) | 770117..770494 | - | 378 | WP_015953067.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| N5O76_RS03790 (770573) | 770573..770794 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| N5O76_RS03795 (770863) | 770863..771339 | - | 477 | WP_001186756.1 | RadC family protein | - |
| N5O76_RS03800 (771354) | 771354..771839 | - | 486 | WP_000860054.1 | antirestriction protein | - |
| N5O76_RS03805 (771930) | 771930..772748 | - | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
| N5O76_RS03810 (772838) | 772838..773071 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
| N5O76_RS03815 (773077) | 773077..773754 | - | 678 | WP_001097312.1 | hypothetical protein | - |
| N5O76_RS03820 (773902) | 773902..774582 | - | 681 | WP_001282927.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13958.84 Da Isoelectric Point: 6.8603
>T258369 WP_001094436.1 NZ_CP104539:c770070-769693 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13766.60 Da Isoelectric Point: 6.2021
>AT258369 WP_015953067.1 NZ_CP104539:c770494-770117 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E2L1N0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Z3CIS0 |