Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 69806..70431 | Replicon | plasmid p1 |
| Accession | NZ_CP104534 | ||
| Organism | Escherichia coli strain E10 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N5O77_RS25455 | Protein ID | WP_000911333.1 |
| Coordinates | 70033..70431 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | V0VCB2 |
| Locus tag | N5O77_RS25450 | Protein ID | WP_000450520.1 |
| Coordinates | 69806..70033 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O77_RS25450 (69806) | 69806..70033 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| N5O77_RS25455 (70033) | 70033..70431 | + | 399 | WP_000911333.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| N5O77_RS25460 (70440) | 70440..72593 | - | 2154 | WP_000009379.1 | type IV conjugative transfer system coupling protein TraD | - |
| N5O77_RS25465 (72846) | 72846..73577 | - | 732 | WP_000850416.1 | conjugal transfer complement resistance protein TraT | - |
| N5O77_RS25470 (73591) | 73591..74100 | - | 510 | WP_000628105.1 | conjugal transfer entry exclusion protein TraS | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..133669 | 133669 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14919.19 Da Isoelectric Point: 7.8605
>T258343 WP_000911333.1 NZ_CP104534:70033-70431 [Escherichia coli]
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|