258341

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 57255..57790 Replicon plasmid p1
Accession NZ_CP104534
Organism Escherichia coli strain E10

Toxin (Protein)


Gene name relE Uniprot ID Q3YTD6
Locus tag N5O77_RS25380 Protein ID WP_000222766.1
Coordinates 57255..57542 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag N5O77_RS25385 Protein ID WP_001132900.1
Coordinates 57539..57790 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O77_RS25355 (53592) 53592..53786 + 195 Protein_46 IS91 family transposase -
N5O77_RS25360 (54065) 54065..54322 + 258 Protein_47 IS3 family transposase -
N5O77_RS25365 (54390) 54390..55541 + 1152 WP_001254932.1 IS30-like element IS30 family transposase -
N5O77_RS25370 (55554) 55554..55721 - 168 Protein_49 IS3 family transposase -
N5O77_RS25375 (55773) 55773..56986 + 1214 WP_172439414.1 IS3 family transposase -
N5O77_RS25380 (57255) 57255..57542 - 288 WP_000222766.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5O77_RS25385 (57539) 57539..57790 - 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N5O77_RS25390 (58756) 58756..59613 - 858 WP_153789778.1 incFII family plasmid replication initiator RepA -
N5O77_RS25395 (59606) 59606..60088 - 483 WP_001273588.1 hypothetical protein -
N5O77_RS25400 (60081) 60081..60128 - 48 WP_229471593.1 hypothetical protein -
N5O77_RS25405 (60119) 60119..60370 + 252 WP_223195197.1 replication protein RepA -
N5O77_RS25410 (60387) 60387..60644 - 258 WP_000083845.1 replication regulatory protein RepA -
N5O77_RS25415 (60928) 60928..61077 - 150 WP_001312851.1 Hok/Gef family protein -
- (61121) 61121..61182 + 62 NuclAT_1 - -
- (61121) 61121..61182 + 62 NuclAT_1 - -
- (61121) 61121..61182 + 62 NuclAT_1 - -
- (61121) 61121..61182 + 62 NuclAT_1 - -
N5O77_RS25420 (61438) 61438..61512 - 75 Protein_59 endonuclease -
N5O77_RS25425 (61758) 61758..61970 - 213 WP_001299730.1 ANR family transcriptional regulator -
N5O77_RS25430 (62106) 62106..62666 - 561 WP_102596227.1 fertility inhibition protein FinO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA 1..133669 133669


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11147.23 Da        Isoelectric Point: 10.5832

>T258341 WP_000222766.1 NZ_CP104534:c57542-57255 [Escherichia coli]
MTYTVKFRDDALKEWLKLDKTIQQQFVKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT258341 WP_001132900.1 NZ_CP104534:c57790-57539 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CDZ2

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References