Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4553158..4553992 | Replicon | chromosome |
| Accession | NZ_CP104533 | ||
| Organism | Escherichia coli strain E10 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | B7MK10 |
| Locus tag | N5O77_RS22685 | Protein ID | WP_000854820.1 |
| Coordinates | 4553615..4553992 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MK11 |
| Locus tag | N5O77_RS22680 | Protein ID | WP_001285610.1 |
| Coordinates | 4553158..4553526 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O77_RS22640 (4548879) | 4548879..4549559 | + | 681 | WP_001278649.1 | WYL domain-containing protein | - |
| N5O77_RS22645 (4549710) | 4549710..4550387 | + | 678 | WP_001097565.1 | hypothetical protein | - |
| N5O77_RS22650 (4550393) | 4550393..4550626 | + | 234 | WP_000883181.1 | DUF905 family protein | - |
| N5O77_RS22655 (4550716) | 4550716..4551534 | + | 819 | WP_001175155.1 | DUF932 domain-containing protein | - |
| N5O77_RS22660 (4551560) | 4551560..4551700 | - | 141 | WP_000997937.1 | hypothetical protein | - |
| N5O77_RS22665 (4551800) | 4551800..4552279 | + | 480 | WP_000706978.1 | antirestriction protein | - |
| N5O77_RS22670 (4552294) | 4552294..4552770 | + | 477 | WP_001186193.1 | RadC family protein | - |
| N5O77_RS22675 (4552857) | 4552857..4553078 | + | 222 | WP_000692347.1 | DUF987 domain-containing protein | - |
| N5O77_RS22680 (4553158) | 4553158..4553526 | + | 369 | WP_001285610.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N5O77_RS22685 (4553615) | 4553615..4553992 | + | 378 | WP_000854820.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| N5O77_RS22690 (4553989) | 4553989..4554186 | + | 198 | Protein_4445 | DUF5983 family protein | - |
| N5O77_RS22695 (4554214) | 4554214..4554411 | + | 198 | WP_085949158.1 | DUF957 domain-containing protein | - |
| N5O77_RS22700 (4554496) | 4554496..4555056 | + | 561 | Protein_4447 | DUF4942 domain-containing protein | - |
| N5O77_RS22705 (4555891) | 4555891..4557429 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | papX | 4493579..4565242 | 71663 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14043.12 Da Isoelectric Point: 7.8839
>T258338 WP_000854820.1 NZ_CP104533:4553615-4553992 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13606.39 Da Isoelectric Point: 6.0618
>AT258338 WP_001285610.1 NZ_CP104533:4553158-4553526 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|