Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3657372..3657990 | Replicon | chromosome |
| Accession | NZ_CP104533 | ||
| Organism | Escherichia coli strain E10 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | N5O77_RS18290 | Protein ID | WP_001291435.1 |
| Coordinates | 3657772..3657990 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | N5O77_RS18285 | Protein ID | WP_000344800.1 |
| Coordinates | 3657372..3657746 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O77_RS18275 (3652462) | 3652462..3653655 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| N5O77_RS18280 (3653678) | 3653678..3656827 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| N5O77_RS18285 (3657372) | 3657372..3657746 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| N5O77_RS18290 (3657772) | 3657772..3657990 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| N5O77_RS18295 (3658164) | 3658164..3658715 | + | 552 | WP_000102543.1 | maltose O-acetyltransferase | - |
| N5O77_RS18300 (3658831) | 3658831..3659301 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| N5O77_RS18305 (3659465) | 3659465..3661015 | + | 1551 | WP_001350616.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| N5O77_RS18310 (3661057) | 3661057..3661410 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| N5O77_RS18320 (3661789) | 3661789..3662100 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| N5O77_RS18325 (3662131) | 3662131..3662703 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T258330 WP_001291435.1 NZ_CP104533:3657772-3657990 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT258330 WP_000344800.1 NZ_CP104533:3657372-3657746 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |