Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1983288..1984119 Replicon chromosome
Accession NZ_CP104533
Organism Escherichia coli strain E10

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag N5O77_RS09625 Protein ID WP_000854814.1
Coordinates 1983288..1983662 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID P76364
Locus tag N5O77_RS09630 Protein ID WP_001285584.1
Coordinates 1983751..1984119 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O77_RS09585 (1978684) 1978684..1979850 + 1167 WP_001513842.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
N5O77_RS09590 (1979969) 1979969..1980442 + 474 WP_001105393.1 DNA gyrase inhibitor SbmC -
N5O77_RS09595 (1980640) 1980640..1981698 + 1059 WP_001200888.1 FUSC family protein -
N5O77_RS09600 (1981870) 1981870..1982199 + 330 WP_000450409.1 DUF496 family protein -
N5O77_RS09605 (1982300) 1982300..1982434 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
N5O77_RS09610 (1982554) 1982554..1982682 + 129 Protein_1884 transposase domain-containing protein -
N5O77_RS09615 (1982971) 1982971..1983051 - 81 Protein_1885 hypothetical protein -
N5O77_RS09620 (1983097) 1983097..1983291 - 195 WP_000988600.1 DUF5983 family protein -
N5O77_RS09625 (1983288) 1983288..1983662 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
N5O77_RS09630 (1983751) 1983751..1984119 - 369 WP_001285584.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
N5O77_RS09635 (1984193) 1984193..1984414 - 222 WP_000692323.1 DUF987 domain-containing protein -
N5O77_RS09640 (1984477) 1984477..1984953 - 477 WP_001186773.1 RadC family protein -
N5O77_RS09645 (1984969) 1984969..1985448 - 480 WP_000860076.1 antirestriction protein -
N5O77_RS09650 (1985530) 1985530..1986348 - 819 WP_001234629.1 DUF932 domain-containing protein -
N5O77_RS09655 (1986448) 1986448..1986681 - 234 WP_001119729.1 DUF905 family protein -
N5O77_RS09660 (1986760) 1986760..1987215 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T258322 WP_000854814.1 NZ_CP104533:c1983662-1983288 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13651.52 Da        Isoelectric Point: 5.9541

>AT258322 WP_001285584.1 NZ_CP104533:c1984119-1983751 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
PDB 2H28
AlphaFold DB A0A1M2E8G6

References