Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1117352..1117935 | Replicon | chromosome |
Accession | NZ_CP104533 | ||
Organism | Escherichia coli strain E10 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | V0SV58 |
Locus tag | N5O77_RS05380 | Protein ID | WP_000254750.1 |
Coordinates | 1117600..1117935 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | N5O77_RS05375 | Protein ID | WP_000581937.1 |
Coordinates | 1117352..1117600 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O77_RS05365 (1113691) | 1113691..1114992 | + | 1302 | WP_000046816.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
N5O77_RS05370 (1115040) | 1115040..1117274 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
N5O77_RS05375 (1117352) | 1117352..1117600 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
N5O77_RS05380 (1117600) | 1117600..1117935 | + | 336 | WP_000254750.1 | endoribonuclease MazF | Toxin |
N5O77_RS05385 (1118007) | 1118007..1118798 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
N5O77_RS05390 (1119026) | 1119026..1120663 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
N5O77_RS05395 (1120751) | 1120751..1122049 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12067.95 Da Isoelectric Point: 8.2618
>T258320 WP_000254750.1 NZ_CP104533:1117600-1117935 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SV58 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LMB4 |