258318

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 831647..832448 Replicon chromosome
Accession NZ_CP104533
Organism Escherichia coli strain E10

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag N5O77_RS04045 Protein ID WP_001094436.1
Coordinates 831647..832024 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag N5O77_RS04050 Protein ID WP_015953067.1
Coordinates 832071..832448 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O77_RS04020 (827850) 827850..828020 - 171 Protein_790 IS110 family transposase -
N5O77_RS04025 (828417) 828417..829952 - 1536 WP_000492897.1 EAL domain-containing protein -
N5O77_RS04030 (830023) 830023..830868 - 846 WP_001280513.1 DUF4942 domain-containing protein -
N5O77_RS04035 (830953) 830953..831150 - 198 WP_000839254.1 DUF957 domain-containing protein -
N5O77_RS04040 (831162) 831162..831650 - 489 WP_000761714.1 DUF5983 family protein -
N5O77_RS04045 (831647) 831647..832024 - 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
N5O77_RS04050 (832071) 832071..832448 - 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
N5O77_RS04055 (832527) 832527..832748 - 222 WP_000692312.1 DUF987 domain-containing protein -
N5O77_RS04060 (832817) 832817..833293 - 477 WP_001186756.1 RadC family protein -
N5O77_RS04065 (833308) 833308..833793 - 486 WP_000860054.1 antirestriction protein -
N5O77_RS04070 (833884) 833884..834702 - 819 WP_001175142.1 DUF932 domain-containing protein -
N5O77_RS04075 (834792) 834792..835025 - 234 WP_001278287.1 DUF905 family protein -
N5O77_RS04080 (835031) 835031..835708 - 678 WP_001097312.1 hypothetical protein -
N5O77_RS04085 (835856) 835856..836536 - 681 WP_001282927.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - rfaE / gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / kpsM / kpsT / neuD / neuB / neuA / neuC / neuE / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / papI / papB / papA / papH / papC / papD / papJ / papK / papE / papF / papG 690848..880595 189747
- flank IS/Tn - - 827850..827954 104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T258318 WP_001094436.1 NZ_CP104533:c832024-831647 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT258318 WP_015953067.1 NZ_CP104533:c832448-832071 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References