Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3534912..3535530 | Replicon | chromosome |
Accession | NZ_CP104526 | ||
Organism | Escherichia coli strain E8 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | N5O73_RS17160 | Protein ID | WP_001291435.1 |
Coordinates | 3535312..3535530 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | N5O73_RS17155 | Protein ID | WP_000344800.1 |
Coordinates | 3534912..3535286 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O73_RS17145 (3530001) | 3530001..3531194 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N5O73_RS17150 (3531217) | 3531217..3534366 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
N5O73_RS17155 (3534912) | 3534912..3535286 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
N5O73_RS17160 (3535312) | 3535312..3535530 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
N5O73_RS17165 (3535702) | 3535702..3536253 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
N5O73_RS17170 (3536369) | 3536369..3536839 | + | 471 | WP_000136192.1 | YlaC family protein | - |
N5O73_RS17175 (3537003) | 3537003..3538553 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
N5O73_RS17180 (3538595) | 3538595..3538948 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
N5O73_RS17190 (3539327) | 3539327..3539638 | + | 312 | WP_000409911.1 | MGMT family protein | - |
N5O73_RS17195 (3539669) | 3539669..3540241 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T258308 WP_001291435.1 NZ_CP104526:3535312-3535530 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT258308 WP_000344800.1 NZ_CP104526:3534912-3535286 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |