Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 871494..872148 | Replicon | chromosome |
| Accession | NZ_CP104526 | ||
| Organism | Escherichia coli strain E8 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | N5O73_RS04235 | Protein ID | WP_000244777.1 |
| Coordinates | 871741..872148 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | N5O73_RS04230 | Protein ID | WP_000354046.1 |
| Coordinates | 871494..871760 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O73_RS04210 (867463) | 867463..868896 | - | 1434 | WP_001514525.1 | 6-phospho-beta-glucosidase BglA | - |
| N5O73_RS04215 (868941) | 868941..869252 | + | 312 | WP_001514524.1 | N(4)-acetylcytidine aminohydrolase | - |
| N5O73_RS04220 (869416) | 869416..870075 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| N5O73_RS04225 (870271) | 870271..871251 | - | 981 | WP_001514522.1 | tRNA-modifying protein YgfZ | - |
| N5O73_RS04230 (871494) | 871494..871760 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| N5O73_RS04235 (871741) | 871741..872148 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
| N5O73_RS04240 (872188) | 872188..872709 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| N5O73_RS04245 (872821) | 872821..873717 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| N5O73_RS04250 (873742) | 873742..874452 | + | 711 | WP_088543385.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N5O73_RS04255 (874458) | 874458..876191 | + | 1734 | WP_000813201.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T258299 WP_000244777.1 NZ_CP104526:871741-872148 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |