Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 53423..53970 Replicon plasmid p1
Accession NZ_CP104524
Organism Escherichia coli strain E7

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag N5O80_RS25505 Protein ID WP_001384452.1
Coordinates 53423..53701 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag N5O80_RS25510 Protein ID WP_000079941.1
Coordinates 53701..53970 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O80_RS25480 (49117) 49117..49464 - 348 WP_000612626.1 IS66 family insertion sequence element accessory protein TnpB -
N5O80_RS25485 (49461) 49461..49865 - 405 WP_000839181.1 transposase -
N5O80_RS25490 (50112) 50112..50447 + 336 WP_001080729.1 colicin 1A immunity protein -
N5O80_RS25495 (50469) 50469..52349 - 1881 WP_001283335.1 colicin Ia central receptor-binding domain-containing protein -
N5O80_RS25500 (52535) 52535..53383 - 849 WP_021573937.1 3'-5' exonuclease -
N5O80_RS25505 (53423) 53423..53701 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
N5O80_RS25510 (53701) 53701..53970 - 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
N5O80_RS25515 (54025) 54025..54183 - 159 WP_000841008.1 hypothetical protein -
N5O80_RS25520 (54807) 54807..56378 - 1572 WP_000381395.1 IS66-like element ISCro1 family transposase -
N5O80_RS25525 (56398) 56398..56745 - 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -
N5O80_RS25530 (56745) 56745..57422 - 678 WP_001339397.1 IS66-like element accessory protein TnpA -
N5O80_RS25535 (57593) 57593..58450 - 858 WP_000130940.1 incFII family plasmid replication initiator RepA -
N5O80_RS25540 (58443) 58443..58490 - 48 WP_077822033.1 hypothetical protein -
N5O80_RS25545 (58481) 58481..58717 + 237 WP_223368648.1 replication protein RepA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..136284 136284
- inside IScluster/Tn - - 47530..57392 9862


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T258291 WP_001384452.1 NZ_CP104524:c53701-53423 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT258291 WP_000079941.1 NZ_CP104524:c53970-53701 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References