Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4883705..4884539 | Replicon | chromosome |
| Accession | NZ_CP104523 | ||
| Organism | Escherichia coli strain E7 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | N5O80_RS23820 | Protein ID | WP_001518317.1 |
| Coordinates | 4884162..4884539 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | N5O80_RS23815 | Protein ID | WP_024187829.1 |
| Coordinates | 4883705..4884073 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O80_RS23780 (4880345) | 4880345..4880800 | + | 456 | WP_001518314.1 | IrmA family protein | - |
| N5O80_RS23785 (4880943) | 4880943..4881032 | + | 90 | WP_112031555.1 | DUF905 family protein | - |
| N5O80_RS23790 (4881211) | 4881211..4882032 | + | 822 | WP_001518315.1 | DUF932 domain-containing protein | - |
| N5O80_RS23795 (4882032) | 4882032..4882277 | + | 246 | WP_001518015.1 | hypothetical protein | - |
| N5O80_RS23800 (4882371) | 4882371..4882844 | + | 474 | WP_001518016.1 | antirestriction protein | - |
| N5O80_RS23805 (4882860) | 4882860..4883336 | + | 477 | WP_001518017.1 | RadC family protein | - |
| N5O80_RS23810 (4883405) | 4883405..4883626 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| N5O80_RS23815 (4883705) | 4883705..4884073 | + | 369 | WP_024187829.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| N5O80_RS23820 (4884162) | 4884162..4884539 | + | 378 | WP_001518317.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| N5O80_RS23825 (4884536) | 4884536..4885024 | + | 489 | WP_001518318.1 | DUF5983 family protein | - |
| N5O80_RS23830 (4885036) | 4885036..4885233 | + | 198 | WP_000839251.1 | DUF957 domain-containing protein | - |
| N5O80_RS23835 (4885318) | 4885318..4886163 | + | 846 | WP_001518322.1 | DUF4942 domain-containing protein | - |
| N5O80_RS23840 (4886756) | 4886756..4887253 | + | 498 | WP_000509808.1 | hypothetical protein | - |
| N5O80_RS23845 (4887420) | 4887420..4888343 | + | 924 | WP_000535959.1 | carboxylate/amino acid/amine transporter | - |
| N5O80_RS23850 (4888347) | 4888347..4889165 | - | 819 | WP_000779405.1 | lipoprotein NlpA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13964.02 Da Isoelectric Point: 8.9341
>T258289 WP_001518317.1 NZ_CP104523:4884162-4884539 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKYPEAKR
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKYPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13631.41 Da Isoelectric Point: 6.2044
>AT258289 WP_024187829.1 NZ_CP104523:4883705-4884073 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|