Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4551558..4552153 Replicon chromosome
Accession NZ_CP104523
Organism Escherichia coli strain E7

Toxin (Protein)


Gene name doc Uniprot ID D6JG31
Locus tag N5O80_RS22265 Protein ID WP_000155159.1
Coordinates 4551558..4551935 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID D6JG32
Locus tag N5O80_RS22270 Protein ID WP_000557315.1
Coordinates 4551932..4552153 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O80_RS22245 (4547056) 4547056..4548126 - 1071 WP_000907828.1 sn-glycerol 3-phosphate ABC transporter ATP binding protein UgpC -
N5O80_RS22250 (4548128) 4548128..4548973 - 846 WP_000572164.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
N5O80_RS22255 (4548970) 4548970..4549857 - 888 WP_000099289.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
N5O80_RS22260 (4550033) 4550033..4551349 - 1317 WP_000803191.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
N5O80_RS22265 (4551558) 4551558..4551935 - 378 WP_000155159.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N5O80_RS22270 (4551932) 4551932..4552153 - 222 WP_000557315.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N5O80_RS22275 (4552241) 4552241..4552954 - 714 WP_000416895.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
N5O80_RS22280 (4552956) 4552956..4553723 - 768 WP_000082101.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
N5O80_RS22285 (4553720) 4553720..4554997 - 1278 WP_000803825.1 branched chain amino acid ABC transporter permease LivM -
N5O80_RS22290 (4554994) 4554994..4555920 - 927 WP_000003010.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
N5O80_RS22295 (4555968) 4555968..4557077 - 1110 WP_001318085.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4546316..4554997 8681
- inside Prophage - - 4546316..4583361 37045


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(27-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-53)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13964.25 Da        Isoelectric Point: 6.7263

>T258284 WP_000155159.1 NZ_CP104523:c4551935-4551558 [Escherichia coli]
MTIQFISAEEIIYFHDKLLSVTPGVTGMSDPGRAEALLYRVLNKYEYEGVSDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILAANPEFVELTVDVAAGKVSLEDIVTRLRQRGT

Download         Length: 378 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8103.24 Da        Isoelectric Point: 6.2168

>AT258284 WP_000557315.1 NZ_CP104523:c4552153-4551932 [Escherichia coli]
MHTMNYSEARQNLALVLETAATGTPVTITRRGHKAAVIISAEEFERYQKAKLDAEFDAIMAIHGSEIKELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB D6JG31

Antitoxin

Source ID Structure
AlphaFold DB D6JG32

References