Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4052743..4053575 Replicon chromosome
Accession NZ_CP104523
Organism Escherichia coli strain E7

Toxin (Protein)


Gene name yeeV Uniprot ID S1PD64
Locus tag N5O80_RS19750 Protein ID WP_000854753.1
Coordinates 4053201..4053575 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID E3PJ72
Locus tag N5O80_RS19745 Protein ID WP_001278232.1
Coordinates 4052743..4053111 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O80_RS19710 (4048576) 4048576..4049256 + 681 WP_001282915.1 WYL domain-containing protein -
N5O80_RS19715 (4049404) 4049404..4050081 + 678 WP_001097305.1 hypothetical protein -
N5O80_RS19720 (4050087) 4050087..4050320 + 234 WP_001278287.1 DUF905 family protein -
N5O80_RS19725 (4050419) 4050419..4051237 + 819 WP_001234631.1 DUF932 domain-containing protein -
N5O80_RS19730 (4051319) 4051319..4051798 + 480 WP_021525716.1 antirestriction protein -
N5O80_RS19735 (4051814) 4051814..4052290 + 477 WP_001186724.1 RadC family protein -
N5O80_RS19740 (4052359) 4052359..4052580 + 222 WP_001405861.1 DUF987 domain-containing protein -
N5O80_RS19745 (4052743) 4052743..4053111 + 369 WP_001278232.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
N5O80_RS19750 (4053201) 4053201..4053575 + 375 WP_000854753.1 TA system toxin CbtA family protein Toxin
N5O80_RS19755 (4053572) 4053572..4054060 + 489 WP_000777541.1 DUF5983 family protein -
N5O80_RS19760 (4054072) 4054072..4054269 + 198 WP_000839281.1 DUF957 domain-containing protein -
N5O80_RS19765 (4054366) 4054366..4054935 + 570 WP_001290247.1 DUF4942 domain-containing protein -
N5O80_RS19770 (4055215) 4055215..4055751 - 537 WP_000942807.1 GspM family type II secretion system protein YghD -
N5O80_RS19775 (4055753) 4055753..4056931 - 1179 WP_000097200.1 type II secretion system protein GspL -
N5O80_RS19780 (4056928) 4056928..4057905 - 978 WP_000633196.1 type II secretion system minor pseudopilin GspK -
N5O80_RS19785 (4057902) 4057902..4058507 - 606 WP_001318033.1 type II secretion system minor pseudopilin GspJ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14005.00 Da        Isoelectric Point: 8.2905

>T258282 WP_000854753.1 NZ_CP104523:4053201-4053575 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13491.37 Da        Isoelectric Point: 6.6290

>AT258282 WP_001278232.1 NZ_CP104523:4052743-4053111 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LVU0

Antitoxin

Source ID Structure
AlphaFold DB E3PJ72

References