Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4052743..4053575 | Replicon | chromosome |
| Accession | NZ_CP104523 | ||
| Organism | Escherichia coli strain E7 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | N5O80_RS19750 | Protein ID | WP_000854753.1 |
| Coordinates | 4053201..4053575 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | E3PJ72 |
| Locus tag | N5O80_RS19745 | Protein ID | WP_001278232.1 |
| Coordinates | 4052743..4053111 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O80_RS19710 (4048576) | 4048576..4049256 | + | 681 | WP_001282915.1 | WYL domain-containing protein | - |
| N5O80_RS19715 (4049404) | 4049404..4050081 | + | 678 | WP_001097305.1 | hypothetical protein | - |
| N5O80_RS19720 (4050087) | 4050087..4050320 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
| N5O80_RS19725 (4050419) | 4050419..4051237 | + | 819 | WP_001234631.1 | DUF932 domain-containing protein | - |
| N5O80_RS19730 (4051319) | 4051319..4051798 | + | 480 | WP_021525716.1 | antirestriction protein | - |
| N5O80_RS19735 (4051814) | 4051814..4052290 | + | 477 | WP_001186724.1 | RadC family protein | - |
| N5O80_RS19740 (4052359) | 4052359..4052580 | + | 222 | WP_001405861.1 | DUF987 domain-containing protein | - |
| N5O80_RS19745 (4052743) | 4052743..4053111 | + | 369 | WP_001278232.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| N5O80_RS19750 (4053201) | 4053201..4053575 | + | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| N5O80_RS19755 (4053572) | 4053572..4054060 | + | 489 | WP_000777541.1 | DUF5983 family protein | - |
| N5O80_RS19760 (4054072) | 4054072..4054269 | + | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| N5O80_RS19765 (4054366) | 4054366..4054935 | + | 570 | WP_001290247.1 | DUF4942 domain-containing protein | - |
| N5O80_RS19770 (4055215) | 4055215..4055751 | - | 537 | WP_000942807.1 | GspM family type II secretion system protein YghD | - |
| N5O80_RS19775 (4055753) | 4055753..4056931 | - | 1179 | WP_000097200.1 | type II secretion system protein GspL | - |
| N5O80_RS19780 (4056928) | 4056928..4057905 | - | 978 | WP_000633196.1 | type II secretion system minor pseudopilin GspK | - |
| N5O80_RS19785 (4057902) | 4057902..4058507 | - | 606 | WP_001318033.1 | type II secretion system minor pseudopilin GspJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T258282 WP_000854753.1 NZ_CP104523:4053201-4053575 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13491.37 Da Isoelectric Point: 6.6290
>AT258282 WP_001278232.1 NZ_CP104523:4052743-4053111 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | E3PJ72 |