Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3882961..3883615 | Replicon | chromosome |
Accession | NZ_CP104523 | ||
Organism | Escherichia coli strain E7 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | N5O80_RS18910 | Protein ID | WP_000244781.1 |
Coordinates | 3882961..3883368 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | N5O80_RS18915 | Protein ID | WP_000354046.1 |
Coordinates | 3883349..3883615 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O80_RS18890 (3878918) | 3878918..3880651 | - | 1734 | WP_000813191.1 | single-stranded-DNA-specific exonuclease RecJ | - |
N5O80_RS18895 (3880657) | 3880657..3881367 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N5O80_RS18900 (3881392) | 3881392..3882288 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
N5O80_RS18905 (3882400) | 3882400..3882921 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
N5O80_RS18910 (3882961) | 3882961..3883368 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
N5O80_RS18915 (3883349) | 3883349..3883615 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
N5O80_RS18920 (3883868) | 3883868..3884848 | + | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
N5O80_RS18925 (3884925) | 3884925..3885584 | - | 660 | WP_000250269.1 | hemolysin III family protein | - |
N5O80_RS18930 (3885748) | 3885748..3886059 | - | 312 | WP_261306703.1 | N(4)-acetylcytidine aminohydrolase | - |
N5O80_RS18935 (3886104) | 3886104..3887537 | + | 1434 | WP_001389468.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T258281 WP_000244781.1 NZ_CP104523:c3883368-3882961 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|