Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2222679..2223315 | Replicon | chromosome |
| Accession | NZ_CP104523 | ||
| Organism | Escherichia coli strain E7 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A5F1EUB3 |
| Locus tag | N5O80_RS10875 | Protein ID | WP_000813796.1 |
| Coordinates | 2222679..2222855 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N5O80_RS10880 | Protein ID | WP_076838470.1 |
| Coordinates | 2222899..2223315 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O80_RS10855 (2218301) | 2218301..2219473 | - | 1173 | WP_001236216.1 | BenE family transporter YdcO | - |
| N5O80_RS10860 (2219565) | 2219565..2220101 | + | 537 | WP_000429147.1 | DNA-binding transcriptional regulator SutR | - |
| N5O80_RS10865 (2220174) | 2220174..2222135 | + | 1962 | WP_001317809.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| N5O80_RS10870 (2222227) | 2222227..2222457 | - | 231 | WP_000494243.1 | YncJ family protein | - |
| N5O80_RS10875 (2222679) | 2222679..2222855 | + | 177 | WP_000813796.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| N5O80_RS10880 (2222899) | 2222899..2223315 | + | 417 | WP_076838470.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| N5O80_RS10885 (2223394) | 2223394..2224800 | + | 1407 | WP_000760605.1 | PLP-dependent aminotransferase family protein | - |
| N5O80_RS10890 (2225045) | 2225045..2226190 | + | 1146 | WP_000047448.1 | ABC transporter substrate-binding protein | - |
| N5O80_RS10895 (2226208) | 2226208..2227221 | + | 1014 | WP_000220433.1 | ABC transporter ATP-binding protein | - |
| N5O80_RS10900 (2227222) | 2227222..2228163 | + | 942 | WP_001251307.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2205000..2223315 | 18315 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6751.78 Da Isoelectric Point: 11.5666
>T258273 WP_000813796.1 NZ_CP104523:2222679-2222855 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLN
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLN
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15219.59 Da Isoelectric Point: 4.5908
>AT258273 WP_076838470.1 NZ_CP104523:2222899-2223315 [Escherichia coli]
MRYPVTLTPAPEGGYVVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYVVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|