Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1861888..1862672 | Replicon | chromosome |
Accession | NZ_CP104523 | ||
Organism | Escherichia coli strain E7 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | N5O80_RS09015 | Protein ID | WP_000613624.1 |
Coordinates | 1861888..1862382 (-) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B1LI61 |
Locus tag | N5O80_RS09020 | Protein ID | WP_001110446.1 |
Coordinates | 1862379..1862672 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O80_RS08995 (1857081) | 1857081..1858178 | + | 1098 | WP_000589326.1 | flagellar basal body P-ring protein FlgI | - |
N5O80_RS09000 (1858178) | 1858178..1859119 | + | 942 | WP_001317765.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
N5O80_RS09005 (1859185) | 1859185..1860828 | + | 1644 | WP_000096482.1 | flagellar hook-associated protein FlgK | - |
N5O80_RS09010 (1860840) | 1860840..1861793 | + | 954 | WP_001212762.1 | flagellar hook-associated protein FlgL | - |
N5O80_RS09015 (1861888) | 1861888..1862382 | - | 495 | WP_000613624.1 | GNAT family N-acetyltransferase | Toxin |
N5O80_RS09020 (1862379) | 1862379..1862672 | - | 294 | WP_001110446.1 | DUF1778 domain-containing protein | Antitoxin |
N5O80_RS09025 (1862806) | 1862806..1865991 | - | 3186 | WP_000827395.1 | ribonuclease E | - |
N5O80_RS09030 (1866564) | 1866564..1867559 | + | 996 | WP_261306745.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18142.04 Da Isoelectric Point: 7.7444
>T258269 WP_000613624.1 NZ_CP104523:c1862382-1861888 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIDRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIDRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|