Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 1614084..1614789 | Replicon | chromosome |
Accession | NZ_CP104523 | ||
Organism | Escherichia coli strain E7 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | N5O80_RS07820 | Protein ID | WP_000539521.1 |
Coordinates | 1614403..1614789 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N5O80_RS07815 | Protein ID | WP_001280945.1 |
Coordinates | 1614084..1614413 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O80_RS07800 (1609241) | 1609241..1610152 | + | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
N5O80_RS07805 (1610330) | 1610330..1612678 | + | 2349 | Protein_1516 | EAL domain-containing protein | - |
N5O80_RS07810 (1612686) | 1612686..1614014 | + | 1329 | WP_000086919.1 | GGDEF domain-containing protein | - |
N5O80_RS07815 (1614084) | 1614084..1614413 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
N5O80_RS07820 (1614403) | 1614403..1614789 | - | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5O80_RS07825 (1615015) | 1615015..1616340 | - | 1326 | WP_000049378.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
N5O80_RS07830 (1616553) | 1616553..1616936 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
N5O80_RS07835 (1617047) | 1617047..1618162 | + | 1116 | WP_000555041.1 | aldose sugar dehydrogenase YliI | - |
N5O80_RS07840 (1618159) | 1618159..1618785 | - | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T258268 WP_000539521.1 NZ_CP104523:c1614789-1614403 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|