Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1205595..1206213 | Replicon | chromosome |
| Accession | NZ_CP104523 | ||
| Organism | Escherichia coli strain E7 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | N5O80_RS05715 | Protein ID | WP_001291435.1 |
| Coordinates | 1205595..1205813 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | N5O80_RS05720 | Protein ID | WP_000344800.1 |
| Coordinates | 1205839..1206213 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O80_RS05680 (1200884) | 1200884..1201456 | + | 573 | WP_000779821.1 | YbaY family lipoprotein | - |
| N5O80_RS05685 (1201487) | 1201487..1201798 | - | 312 | WP_000409911.1 | MGMT family protein | - |
| N5O80_RS05695 (1202177) | 1202177..1202530 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| N5O80_RS05700 (1202572) | 1202572..1204122 | - | 1551 | WP_001317659.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| N5O80_RS05705 (1204286) | 1204286..1204756 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| N5O80_RS05710 (1204872) | 1204872..1205423 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| N5O80_RS05715 (1205595) | 1205595..1205813 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| N5O80_RS05720 (1205839) | 1205839..1206213 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| N5O80_RS05725 (1206759) | 1206759..1209908 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| N5O80_RS05730 (1209931) | 1209931..1211124 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T258266 WP_001291435.1 NZ_CP104523:c1205813-1205595 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT258266 WP_000344800.1 NZ_CP104523:c1206213-1205839 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |