Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 538122..538957 | Replicon | chromosome |
| Accession | NZ_CP104523 | ||
| Organism | Escherichia coli strain E7 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | V0Z9U3 |
| Locus tag | N5O80_RS02590 | Protein ID | WP_000854750.1 |
| Coordinates | 538580..538957 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | E3PJ72 |
| Locus tag | N5O80_RS02585 | Protein ID | WP_001278232.1 |
| Coordinates | 538122..538490 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O80_RS02550 (533921) | 533921..534601 | + | 681 | WP_094122466.1 | WYL domain-containing protein | - |
| N5O80_RS02555 (534749) | 534749..535426 | + | 678 | WP_001097305.1 | hypothetical protein | - |
| N5O80_RS02560 (535432) | 535432..535665 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
| N5O80_RS02565 (535764) | 535764..536582 | + | 819 | WP_077737895.1 | DUF932 domain-containing protein | - |
| N5O80_RS02570 (536674) | 536674..537159 | + | 486 | WP_000206658.1 | antirestriction protein | - |
| N5O80_RS02575 (537175) | 537175..537651 | + | 477 | WP_001367707.1 | RadC family protein | - |
| N5O80_RS02580 (537738) | 537738..537959 | + | 222 | WP_000691819.1 | DUF987 domain-containing protein | - |
| N5O80_RS02585 (538122) | 538122..538490 | + | 369 | WP_001278232.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| N5O80_RS02590 (538580) | 538580..538957 | + | 378 | WP_000854750.1 | TA system toxin CbtA family protein | Toxin |
| N5O80_RS02595 (538954) | 538954..539442 | + | 489 | WP_000761685.1 | DUF5983 family protein | - |
| N5O80_RS02600 (539454) | 539454..539651 | + | 198 | WP_000839280.1 | DUF957 domain-containing protein | - |
| N5O80_RS02605 (539736) | 539736..539879 | + | 144 | Protein_503 | hypothetical protein | - |
| N5O80_RS02610 (540835) | 540835..542871 | + | 2037 | WP_000417002.1 | hypothetical protein | - |
| N5O80_RS02615 (543270) | 543270..543449 | - | 180 | Protein_505 | peptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimB / fimE | 526689..551180 | 24491 | |
| - | inside | Genomic island | - | fimB / fimE / fimA / fimI / fimC | 526689..553576 | 26887 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13919.90 Da Isoelectric Point: 8.2905
>T258264 WP_000854750.1 NZ_CP104523:538580-538957 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|