Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 538122..538957 Replicon chromosome
Accession NZ_CP104523
Organism Escherichia coli strain E7

Toxin (Protein)


Gene name yeeV Uniprot ID V0Z9U3
Locus tag N5O80_RS02590 Protein ID WP_000854750.1
Coordinates 538580..538957 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID E3PJ72
Locus tag N5O80_RS02585 Protein ID WP_001278232.1
Coordinates 538122..538490 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O80_RS02550 (533921) 533921..534601 + 681 WP_094122466.1 WYL domain-containing protein -
N5O80_RS02555 (534749) 534749..535426 + 678 WP_001097305.1 hypothetical protein -
N5O80_RS02560 (535432) 535432..535665 + 234 WP_001278287.1 DUF905 family protein -
N5O80_RS02565 (535764) 535764..536582 + 819 WP_077737895.1 DUF932 domain-containing protein -
N5O80_RS02570 (536674) 536674..537159 + 486 WP_000206658.1 antirestriction protein -
N5O80_RS02575 (537175) 537175..537651 + 477 WP_001367707.1 RadC family protein -
N5O80_RS02580 (537738) 537738..537959 + 222 WP_000691819.1 DUF987 domain-containing protein -
N5O80_RS02585 (538122) 538122..538490 + 369 WP_001278232.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
N5O80_RS02590 (538580) 538580..538957 + 378 WP_000854750.1 TA system toxin CbtA family protein Toxin
N5O80_RS02595 (538954) 538954..539442 + 489 WP_000761685.1 DUF5983 family protein -
N5O80_RS02600 (539454) 539454..539651 + 198 WP_000839280.1 DUF957 domain-containing protein -
N5O80_RS02605 (539736) 539736..539879 + 144 Protein_503 hypothetical protein -
N5O80_RS02610 (540835) 540835..542871 + 2037 WP_000417002.1 hypothetical protein -
N5O80_RS02615 (543270) 543270..543449 - 180 Protein_505 peptidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fimB / fimE 526689..551180 24491
- inside Genomic island - fimB / fimE / fimA / fimI / fimC 526689..553576 26887


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13919.90 Da        Isoelectric Point: 8.2905

>T258264 WP_000854750.1 NZ_CP104523:538580-538957 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13491.37 Da        Isoelectric Point: 6.6290

>AT258264 WP_001278232.1 NZ_CP104523:538122-538490 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0Z9U3

Antitoxin

Source ID Structure
AlphaFold DB E3PJ72

References