Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 292419..293220 | Replicon | chromosome |
Accession | NZ_CP104523 | ||
Organism | Escherichia coli strain E7 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | D8EBK0 |
Locus tag | N5O80_RS01345 | Protein ID | WP_001094436.1 |
Coordinates | 292419..292796 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | B7MN76 |
Locus tag | N5O80_RS01350 | Protein ID | WP_015953067.1 |
Coordinates | 292843..293220 (-) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O80_RS01325 (289189) | 289189..290724 | - | 1536 | WP_000492897.1 | EAL domain-containing protein | - |
N5O80_RS01330 (290795) | 290795..291640 | - | 846 | WP_001280513.1 | DUF4942 domain-containing protein | - |
N5O80_RS01335 (291725) | 291725..291922 | - | 198 | WP_000839254.1 | DUF957 domain-containing protein | - |
N5O80_RS01340 (291934) | 291934..292422 | - | 489 | WP_000761714.1 | DUF5983 family protein | - |
N5O80_RS01345 (292419) | 292419..292796 | - | 378 | WP_001094436.1 | TA system toxin CbtA family protein | Toxin |
N5O80_RS01350 (292843) | 292843..293220 | - | 378 | WP_015953067.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
N5O80_RS01355 (293299) | 293299..293520 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
N5O80_RS01360 (293589) | 293589..294065 | - | 477 | WP_001186756.1 | RadC family protein | - |
N5O80_RS01365 (294080) | 294080..294565 | - | 486 | WP_000860054.1 | antirestriction protein | - |
N5O80_RS01370 (294656) | 294656..295474 | - | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
N5O80_RS01375 (295564) | 295564..295797 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
N5O80_RS01380 (295803) | 295803..296480 | - | 678 | WP_001097305.1 | hypothetical protein | - |
N5O80_RS01385 (296628) | 296628..297308 | - | 681 | WP_001282915.1 | WYL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13958.84 Da Isoelectric Point: 6.8603
>T258263 WP_001094436.1 NZ_CP104523:c292796-292419 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13766.60 Da Isoelectric Point: 6.2021
>AT258263 WP_015953067.1 NZ_CP104523:c293220-292843 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E2L1N0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Z3CIS0 |