Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 53631..54178 Replicon plasmid p1
Accession NZ_CP104522
Organism Escherichia coli strain E5

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag N5O78_RS24290 Protein ID WP_001384452.1
Coordinates 53631..53909 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag N5O78_RS24295 Protein ID WP_000079941.1
Coordinates 53909..54178 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O78_RS24265 (49319) 49319..49666 - 348 WP_000612626.1 IS66 family insertion sequence element accessory protein TnpB -
N5O78_RS24270 (49663) 49663..50067 - 405 WP_000839181.1 transposase -
N5O78_RS24275 (50314) 50314..50649 + 336 WP_001080729.1 colicin 1A immunity protein -
N5O78_RS24280 (50671) 50671..52551 - 1881 WP_001283335.1 colicin Ia central receptor-binding domain-containing protein -
N5O78_RS24285 (52737) 52737..53585 - 849 WP_001057989.1 3'-5' exonuclease -
N5O78_RS24290 (53631) 53631..53909 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
N5O78_RS24295 (53909) 53909..54178 - 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
N5O78_RS24300 (55094) 55094..55951 - 858 WP_000130940.1 incFII family plasmid replication initiator RepA -
N5O78_RS24305 (55944) 55944..55991 - 48 WP_077822033.1 hypothetical protein -
N5O78_RS24310 (55982) 55982..56218 + 237 WP_223368648.1 replication protein RepA -
N5O78_RS24315 (56244) 56244..56504 - 261 WP_000083818.1 replication regulatory protein RepA -
N5O78_RS24320 (56594) 56594..56950 - 357 Protein_57 thermonuclease family protein -
N5O78_RS24325 (57193) 57193..57405 - 213 WP_001311693.1 hypothetical protein -
N5O78_RS24330 (57543) 57543..58103 - 561 WP_000139359.1 fertility inhibition protein FinO -
N5O78_RS24335 (58158) 58158..58903 - 746 Protein_60 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..133719 133719


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T258261 WP_001384452.1 NZ_CP104522:c53909-53631 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT258261 WP_000079941.1 NZ_CP104522:c54178-53909 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References