Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3883725..3884557 | Replicon | chromosome |
Accession | NZ_CP104521 | ||
Organism | Escherichia coli strain E5 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1PD64 |
Locus tag | N5O78_RS18805 | Protein ID | WP_000854753.1 |
Coordinates | 3884183..3884557 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | E3PJ72 |
Locus tag | N5O78_RS18800 | Protein ID | WP_001278232.1 |
Coordinates | 3883725..3884093 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O78_RS18765 (3879568) | 3879568..3880248 | + | 681 | WP_001593697.1 | WYL domain-containing protein | - |
N5O78_RS18770 (3880396) | 3880396..3881073 | + | 678 | WP_094122412.1 | hypothetical protein | - |
N5O78_RS18775 (3881079) | 3881079..3881312 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
N5O78_RS18780 (3881411) | 3881411..3882229 | + | 819 | WP_094122413.1 | DUF932 domain-containing protein | - |
N5O78_RS18785 (3882311) | 3882311..3882790 | + | 480 | WP_000860065.1 | antirestriction protein | - |
N5O78_RS18790 (3882802) | 3882802..3883278 | + | 477 | WP_001186710.1 | RadC family protein | - |
N5O78_RS18795 (3883341) | 3883341..3883562 | + | 222 | WP_000692303.1 | DUF987 domain-containing protein | - |
N5O78_RS18800 (3883725) | 3883725..3884093 | + | 369 | WP_001278232.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
N5O78_RS18805 (3884183) | 3884183..3884557 | + | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
N5O78_RS18810 (3884554) | 3884554..3885042 | + | 489 | WP_000777541.1 | DUF5983 family protein | - |
N5O78_RS18815 (3885054) | 3885054..3885251 | + | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
N5O78_RS18820 (3885348) | 3885348..3885917 | + | 570 | WP_001290247.1 | DUF4942 domain-containing protein | - |
N5O78_RS18825 (3886197) | 3886197..3886733 | - | 537 | WP_000942807.1 | GspM family type II secretion system protein YghD | - |
N5O78_RS18830 (3886735) | 3886735..3887912 | - | 1178 | Protein_3678 | type II secretion system protein GspL | - |
N5O78_RS18835 (3887909) | 3887909..3888886 | - | 978 | WP_000633196.1 | type II secretion system minor pseudopilin GspK | - |
N5O78_RS18840 (3888883) | 3888883..3889488 | - | 606 | WP_001318033.1 | type II secretion system minor pseudopilin GspJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T258253 WP_000854753.1 NZ_CP104521:3884183-3884557 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13491.37 Da Isoelectric Point: 6.6290
>AT258253 WP_001278232.1 NZ_CP104521:3883725-3884093 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LVU0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | E3PJ72 |