Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3670308..3670962 | Replicon | chromosome |
| Accession | NZ_CP104521 | ||
| Organism | Escherichia coli strain E5 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | N5O78_RS17740 | Protein ID | WP_000244781.1 |
| Coordinates | 3670308..3670715 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | N5O78_RS17745 | Protein ID | WP_000354046.1 |
| Coordinates | 3670696..3670962 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O78_RS17720 (3666265) | 3666265..3667998 | - | 1734 | WP_000813191.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| N5O78_RS17725 (3668004) | 3668004..3668714 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N5O78_RS17730 (3668739) | 3668739..3669635 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| N5O78_RS17735 (3669747) | 3669747..3670268 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| N5O78_RS17740 (3670308) | 3670308..3670715 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| N5O78_RS17745 (3670696) | 3670696..3670962 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| N5O78_RS17750 (3671215) | 3671215..3672195 | + | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
| N5O78_RS17755 (3672272) | 3672272..3672931 | - | 660 | WP_000250269.1 | hemolysin III family protein | - |
| N5O78_RS17760 (3673095) | 3673095..3673406 | - | 312 | WP_001182953.1 | N(4)-acetylcytidine aminohydrolase | - |
| N5O78_RS17765 (3673451) | 3673451..3674884 | + | 1434 | WP_001389468.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T258252 WP_000244781.1 NZ_CP104521:c3670715-3670308 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|