Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3222906..3223531 | Replicon | chromosome |
| Accession | NZ_CP104521 | ||
| Organism | Escherichia coli strain E5 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U9YZ02 |
| Locus tag | N5O78_RS15710 | Protein ID | WP_000911329.1 |
| Coordinates | 3222906..3223304 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | N5O78_RS15715 | Protein ID | WP_000450524.1 |
| Coordinates | 3223304..3223531 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O78_RS15690 (3218813) | 3218813..3219013 | + | 201 | WP_000383836.1 | YpfN family protein | - |
| N5O78_RS15695 (3219094) | 3219094..3219792 | - | 699 | WP_000679819.1 | esterase | - |
| N5O78_RS15700 (3219866) | 3219866..3221881 | - | 2016 | WP_000829310.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| N5O78_RS15705 (3221896) | 3221896..3222759 | - | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| N5O78_RS15710 (3222906) | 3222906..3223304 | - | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N5O78_RS15715 (3223304) | 3223304..3223531 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| N5O78_RS15720 (3223688) | 3223688..3224401 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| N5O78_RS15725 (3224614) | 3224614..3225648 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| N5O78_RS15730 (3225665) | 3225665..3226543 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| N5O78_RS15735 (3226689) | 3226689..3227261 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| N5O78_RS15740 (3227261) | 3227261..3227731 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T258251 WP_000911329.1 NZ_CP104521:c3223304-3222906 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XW84 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CM33 |