Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2091972..2092608 | Replicon | chromosome |
Accession | NZ_CP104521 | ||
Organism | Escherichia coli strain E5 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A5F1EUB3 |
Locus tag | N5O78_RS10110 | Protein ID | WP_000813796.1 |
Coordinates | 2091972..2092148 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N5O78_RS10115 | Protein ID | WP_076838470.1 |
Coordinates | 2092192..2092608 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5O78_RS10090 (2087594) | 2087594..2088766 | - | 1173 | WP_001236216.1 | BenE family transporter YdcO | - |
N5O78_RS10095 (2088858) | 2088858..2089394 | + | 537 | WP_000429147.1 | DNA-binding transcriptional regulator SutR | - |
N5O78_RS10100 (2089467) | 2089467..2091428 | + | 1962 | WP_001317809.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N5O78_RS10105 (2091520) | 2091520..2091750 | - | 231 | WP_000494243.1 | YncJ family protein | - |
N5O78_RS10110 (2091972) | 2091972..2092148 | + | 177 | WP_000813796.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N5O78_RS10115 (2092192) | 2092192..2092608 | + | 417 | WP_076838470.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N5O78_RS10120 (2092687) | 2092687..2094093 | + | 1407 | WP_000760605.1 | PLP-dependent aminotransferase family protein | - |
N5O78_RS10125 (2094338) | 2094338..2095483 | + | 1146 | WP_094122354.1 | ABC transporter substrate-binding protein | - |
N5O78_RS10130 (2095501) | 2095501..2096514 | + | 1014 | WP_000220433.1 | ABC transporter ATP-binding protein | - |
N5O78_RS10135 (2096515) | 2096515..2097456 | + | 942 | WP_001251307.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6751.78 Da Isoelectric Point: 11.5666
>T258244 WP_000813796.1 NZ_CP104521:2091972-2092148 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLN
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLN
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15219.59 Da Isoelectric Point: 4.5908
>AT258244 WP_076838470.1 NZ_CP104521:2092192-2092608 [Escherichia coli]
MRYPVTLTPAPEGGYVVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYVVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|