Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1783720..1784504 | Replicon | chromosome |
| Accession | NZ_CP104521 | ||
| Organism | Escherichia coli strain E5 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | - |
| Locus tag | N5O78_RS08550 | Protein ID | WP_000613624.1 |
| Coordinates | 1783720..1784214 (-) | Length | 165 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | B1LI61 |
| Locus tag | N5O78_RS08555 | Protein ID | WP_001110446.1 |
| Coordinates | 1784211..1784504 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O78_RS08530 (1778913) | 1778913..1780010 | + | 1098 | WP_000589326.1 | flagellar basal body P-ring protein FlgI | - |
| N5O78_RS08535 (1780010) | 1780010..1780951 | + | 942 | WP_001317765.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
| N5O78_RS08540 (1781017) | 1781017..1782660 | + | 1644 | WP_000096482.1 | flagellar hook-associated protein FlgK | - |
| N5O78_RS08545 (1782672) | 1782672..1783625 | + | 954 | WP_001212762.1 | flagellar hook-associated protein FlgL | - |
| N5O78_RS08550 (1783720) | 1783720..1784214 | - | 495 | WP_000613624.1 | GNAT family N-acetyltransferase | Toxin |
| N5O78_RS08555 (1784211) | 1784211..1784504 | - | 294 | WP_001110446.1 | DUF1778 domain-containing protein | Antitoxin |
| N5O78_RS08560 (1784638) | 1784638..1787823 | - | 3186 | WP_000827395.1 | ribonuclease E | - |
| N5O78_RS08565 (1788396) | 1788396..1789355 | + | 960 | WP_000846329.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18142.04 Da Isoelectric Point: 7.7444
>T258243 WP_000613624.1 NZ_CP104521:c1784214-1783720 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIDRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIDRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|