Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 1536802..1537507 | Replicon | chromosome |
| Accession | NZ_CP104521 | ||
| Organism | Escherichia coli strain E5 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | N5O78_RS07365 | Protein ID | WP_000539521.1 |
| Coordinates | 1537121..1537507 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | N5O78_RS07360 | Protein ID | WP_001280945.1 |
| Coordinates | 1536802..1537131 (-) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O78_RS07345 (1531959) | 1531959..1532870 | + | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
| N5O78_RS07350 (1533048) | 1533048..1535396 | + | 2349 | Protein_1425 | EAL domain-containing protein | - |
| N5O78_RS07355 (1535404) | 1535404..1536732 | + | 1329 | WP_096002626.1 | GGDEF domain-containing protein | - |
| N5O78_RS07360 (1536802) | 1536802..1537131 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| N5O78_RS07365 (1537121) | 1537121..1537507 | - | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5O78_RS07370 (1537733) | 1537733..1539058 | - | 1326 | WP_000049378.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| N5O78_RS07375 (1539271) | 1539271..1539654 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| N5O78_RS07380 (1539765) | 1539765..1540880 | + | 1116 | WP_000555041.1 | aldose sugar dehydrogenase YliI | - |
| N5O78_RS07385 (1540877) | 1540877..1541503 | - | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T258242 WP_000539521.1 NZ_CP104521:c1537507-1537121 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|